Kv3.4 Antibody


Immunocytochemistry/ Immunofluorescence: Kv3.4 Antibody [NBP1-89887] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoli & cytosol.
Immunohistochemistry-Paraffin: Kv3.4 Antibody [NBP1-89887] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

Kv3.4 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:ISSVCVSSYRGRKSGNKPPSKTCLKEEMAKGEASEKIIINVGGTRHETYRSTLRTLPGTRLAWLADPD
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (96%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Kv3.4 Protein (NBP1-89887PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Kv3.4 Antibody

  • K+ channel subunit
  • KV3.4
  • MGC126818
  • potassium voltage-gated channel subfamily C member 4
  • potassium voltage-gated channel, Shaw-related subfamily, member 4
  • Voltage-gated potassium channel subunit Kv3.4


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC
Species: Hu
Applications: WB
Species: Hu, Mu, Rt, Bv, Ca, Rb
Applications: WB, B/N, IP
Species: Hu, Mu, Rt, Po, Bv, Ca, Xp, Ze
Applications: WB, ICC/IF, IP
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: WB, ELISA, RNAi
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC
Species: Hu

Publications for Kv3.4 Antibody (NBP1-89887) (0)

There are no publications for Kv3.4 Antibody (NBP1-89887).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kv3.4 Antibody (NBP1-89887) (0)

There are no reviews for Kv3.4 Antibody (NBP1-89887). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Kv3.4 Antibody (NBP1-89887) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Kv3.4 Products

Bioinformatics Tool for Kv3.4 Antibody (NBP1-89887)

Discover related pathways, diseases and genes to Kv3.4 Antibody (NBP1-89887). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kv3.4 Antibody (NBP1-89887)

Discover more about diseases related to Kv3.4 Antibody (NBP1-89887).

Pathways for Kv3.4 Antibody (NBP1-89887)

View related products by pathway.

PTMs for Kv3.4 Antibody (NBP1-89887)

Learn more about PTMs related to Kv3.4 Antibody (NBP1-89887).

Blogs on Kv3.4

There are no specific blogs for Kv3.4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Kv3.4 Antibody and receive a gift card or discount.


Gene Symbol KCNC4