Recombinant Human Kv3.3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Kv3.3 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 671 - 757 of Human KCNC3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:ALAHEDCPAIDQPAMSPEDKSPITPGSRGRYSRDRACFLLTDYAPSPDGSIRKATGAPPLPPQDWRKPGPPSFLPDLNANAAAWISP

Protein/Peptide Type
Partial Recombinant Protein
Gene
KCNC3

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
10 mM NH4HCO3, pH 7.4

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Kv3.3 Protein

  • KSHIIID
  • KV3.3
  • potassium voltage-gated channel subfamily C member 3
  • potassium voltage-gated channel, Shaw-related subfamily, member 3
  • SCA13
  • Shaw-related voltage-gated potassium channel protein 3
  • spinocerebellar ataxia 13
  • voltage-gated potassium channel protein KV3.3
  • Voltage-gated potassium channel subunit Kv3.3

Background

KCNC3 - potassium voltage-gated channel, Shaw-related subfamily, member 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-42819
Species: Hu, Mu, Rt, Bv, Ca, Rb
Applications: WB, B/N, IP
NBP1-47609
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-59328
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-89691
Species: Hu
Applications: IHC, IHC-P
NBP2-52497
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC
NBP2-19315
Species: Hu
Applications: WB
NBP2-38498
Species: Hu
Applications: IHC, IHC-P
AF2086
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-33891
Species: Hu
Applications: IHC, IHC-P
NBP1-42802
Species: Hu, Mu, Rt, Po, Bv, Ca, Xp, Ze
Applications: WB, ICC/IF, IP
H00003738-M01
Species: Hu
Applications: WB, ELISA
NBP2-42202
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-21398
Species: Hu, Mu
Applications: WB, IHC-P, IP, IF
NBP2-46627
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF5130
Species: Hu, Mu, Rt
Applications: WB
NBP1-92476
Species: Hu
Applications: IHC, IHC-P
NB110-58346
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-55745
Species: Hu
Applications: ICC/IF
NBP1-81336
Species: Hu
Applications: WB, IHC, IHC-P
H00003748-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Kv3.3 Partial Recombinant Protein (H00003748-Q01) (0)

There are no publications for Kv3.3 Partial Recombinant Protein (H00003748-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kv3.3 Partial Recombinant Protein (H00003748-Q01) (0)

There are no reviews for Kv3.3 Partial Recombinant Protein (H00003748-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Kv3.3 Partial Recombinant Protein (H00003748-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Kv3.3 Products

Bioinformatics Tool for Kv3.3 Partial Recombinant Protein (H00003748-Q01)

Discover related pathways, diseases and genes to Kv3.3 Partial Recombinant Protein (H00003748-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kv3.3 Partial Recombinant Protein (H00003748-Q01)

Discover more about diseases related to Kv3.3 Partial Recombinant Protein (H00003748-Q01).
 

Pathways for Kv3.3 Partial Recombinant Protein (H00003748-Q01)

View related products by pathway.

PTMs for Kv3.3 Partial Recombinant Protein (H00003748-Q01)

Learn more about PTMs related to Kv3.3 Partial Recombinant Protein (H00003748-Q01).

Blogs on Kv3.3

There are no specific blogs for Kv3.3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Kv3.3 Antibody (1C1)
H00003748-M01

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Kv3.3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNC3