Kv11.2 Antibody


Western Blot: Kv11.2 Antibody [NBP2-84127] - WB Suggested Anti-KCNH6 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: NCI-H226 cell lysateKCNH6 is strongly supported by BioGPS gene expression ...read more

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

Kv11.2 Antibody Summary

The immunogen is a synthetic peptide directed towards the middle region of human Kv11.2. Peptide sequence: PLASPLHPLEVQGLICGPCFSSLPEHLGSVPKQLDFQRHGSDPGFAGSWG The peptide sequence for this immunogen was taken from within the described region.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified

Alternate Names for Kv11.2 Antibody

  • eag related protein 2
  • eag-related gene member 2
  • Eag-related protein 2
  • ERG2
  • ERG-2
  • ether-a-go-go related gene potassium channel 2
  • Ether-a-go-go-related gene potassium channel 2
  • Ether-a-go-go-related protein 2
  • hERG2
  • hERG-2
  • KCNH6
  • Kv11.2
  • potassium voltage-gated channel subfamily H member 6
  • potassium voltage-gated channel, subfamily H (eag-related), member 6
  • Voltage-gated potassium channel subunit Kv11.2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC-P, IP, WB
Species: Ca, Gp, Hu, Pm, Rt
Applications: ELISA, ICC/IF, KD, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IP, RIA, WB
Species: Hu, Mu
Applications: IP, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Mu
Applications: Bind
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB

Publications for Kv11.2 Antibody (NBP2-84127) (0)

There are no publications for Kv11.2 Antibody (NBP2-84127).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kv11.2 Antibody (NBP2-84127) (0)

There are no reviews for Kv11.2 Antibody (NBP2-84127). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Kv11.2 Antibody (NBP2-84127) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Kv11.2 Products

Bioinformatics Tool for Kv11.2 Antibody (NBP2-84127)

Discover related pathways, diseases and genes to Kv11.2 Antibody (NBP2-84127). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kv11.2 Antibody (NBP2-84127)

Discover more about diseases related to Kv11.2 Antibody (NBP2-84127).

Pathways for Kv11.2 Antibody (NBP2-84127)

View related products by pathway.

PTMs for Kv11.2 Antibody (NBP2-84127)

Learn more about PTMs related to Kv11.2 Antibody (NBP2-84127).

Research Areas for Kv11.2 Antibody (NBP2-84127)

Find related products by research area.

Blogs on Kv11.2

There are no specific blogs for Kv11.2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Kv11.2 Antibody and receive a gift card or discount.


Gene Symbol KCNH6