Home » Kv11.2 » Kv11.2 Antibodies » Kv11.2 Antibody

Kv11.2 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: Kv11.2 Antibody [NBP2-84127] - WB Suggested Anti-KCNH6 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: NCI-H226 cell lysateKCNH6 is strongly supported by BioGPS gene expression data to be expressed in NCI-H226
Western Blot: Kv11.2 Antibody [NBP2-84127] - WB Suggested Anti-KCNH6 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: NCI-H226 cell lysateKCNH6 is strongly supported by BioGPS gene expression ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Kv11.2 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human Kv11.2. Peptide sequence: PLASPLHPLEVQGLICGPCFSSLPEHLGSVPKQLDFQRHGSDPGFAGSWG The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
KCNH6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Kv11.2 Antibody

  • eag related protein 2
  • eag-related gene member 2
  • Eag-related protein 2
  • ERG2
  • ERG-2
  • ether-a-go-go related gene potassium channel 2
  • Ether-a-go-go-related gene potassium channel 2
  • Ether-a-go-go-related protein 2
  • hERG2
  • hERG-2
  • KCNH6
  • Kv11.2
  • potassium voltage-gated channel subfamily H member 6
  • potassium voltage-gated channel, subfamily H (eag-related), member 6
  • Voltage-gated potassium channel subunit Kv11.2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Kv11.1 Antibody
NBP3-03109
Immunohistochemistry-Paraffin: Kv11.1 Antibody [NBP3-03109] - Paraffin-embedded human breast cancer using Kv11.1 antibody at dilution of 1:100 (40x lens).
Immunohistochemistry-Paraffin: Kv11.1 Antibody [NBP3-03109] - Paraffin-embedded human colon carcinoma using Kv11.1 antibody at dilution of 1:100 (40x lens).
Western Blot: Kv11.1 Antibody [NBP3-03109] - Analysis of extracts of various cell lines, using Kv11.1 antibody at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhan
Species: Hu, Mu
Applications: IHC, IHC-P, WB
ERG Antibody - BSA
Free
NBP2-60655
Immunocytochemistry/Immunofluorescence: ERG Antibody [NBP2-60655] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-ERG at 5 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Alpha tubulin (DM1A) NB100-690 was used as a co-stain at a 1:1000 dilution and detected with an anti-mouse Dylight 550 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Western Blot: ERG Antibody [NBP2-60655] - Total protein from Human THP-1, Jurkat and K562 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-ERG in blocking buffer and detected with an anti-rabbit HRP secondary antibody using chemiluminescence.
Immunohistochemistry-Paraffin: ERG Antibody [NBP2-60655] - IHC analysis of a formalin fixed paraffin embedded tissue section of the human kidney (NBP1-78269) using 1:100 dilution of ERG antibody. The signal was developed using HRP-DAB method which followed counterstaining of the cells with hematoxylin. The antibody generated mainly a nuclear staining with weak cytoplasmic positivity in the cells of the glomeruli and the tubular epithelial cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Kv7.1 Antibody
(S37A/10)
NBP2-12897
Immunohistochemistry: Kv7.1 Antibody (S37A/10) [NBP2-12897] - Tissue: hippocampus. Species: Human. Fixation: Bouin's Fixative and paraffin-embedded. Primary Antibody: Mouse Anti-KCNQ1 Monoclonal Antibody at 1:1000 for 1 hour at RT. Secondary Antibody: FITC Goat Anti-Mouse (green) at 1:50 for 1 hour at RT.
Western Blot: Kv7.1 Antibody (S37A/10) [NBP2-12897] - Western Blot analysis of Human Cell lysates showing detection of Kv7.1 protein using Mouse Anti-Kv7.1 Monoclonal Antibody, Clone N37A/10 (NBP2-12897). Load: 15 ug. Block: 1.5% BSA for 30 minutes at RT. Primary Antibody: Mouse Anti-Kv7.1 Monoclonal Antibody (NBP2-12897) at 1:1000 for 2 hours at RT. Secondary Antibody: Sheep Anti-Mouse IgG: HRP for 1 hour at RT.
Immunohistochemistry: Kv7.1 Antibody (S37A/10) [NBP2-12897] - Immunohistochemistry analysis using Mouse Anti-Kv7.1 Monoclonal Antibody, Clone N37A/10 (NBP2-12897). Tissue: hippocampus. Species: Human. Fixation: Bouin's Fixative and paraffin-embedded. Primary Antibody: Mouse Anti-Kv7.1 Monoclonal Antibody (NBP2-12897) at 1:1000 for 1 hour at RT. Secondary Antibody: FITC Goat Anti-Mouse (green) at 1:50 for 1 hour at RT.
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
Kv11.3 Antibody
NBP3-06083
Immunohistochemistry-Paraffin: Kv11.3 Antibody [NBP3-06083] - Immunochemical staining of human Kv11.3 in human rectum with rabbit polyclonal antibody at 1:500 dilution, formalin-fixed paraffin embedded sections.
Immunohistochemistry-Paraffin: Kv11.3 Antibody [NBP3-06083] - Immunochemical staining of human Kv11.3 in cynomolgus heart with rabbit polyclonal antibody at 1:500 dilution, formalin-fixed paraffin embedded sections.
Species: Hu
Applications: ELISA, ICC/IF, IHC-P, IP, WB
KCNE1 Antibody
(5B12)
H00003753-M01
ELISA: KCNE1 Antibody (5B12) [H00003753-M01] - Detection limit for recombinant GST tagged KCNE1 is approximately 3ng/ml as a capture antibody.
Western Blot: KCNE1 Antibody (5B12) [H00003753-M01] - analysis of KCNE1 expression in transfected 293T cell line by KCNE1 monoclonal antibody (M01), clone 5B12. Lane 1: KCNE1 transfected lysate (14.7 KDa). Lane 2: Non-transfected lysate.
Western Blot: KCNE1 Antibody (5B12) [H00003753-M01] - Analysis of KCNE1 over-expressed 293 cell line, cotransfected with KCNE1 Validated Chimera RNAi ( Cat # H00003753-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with KCNE1 monoclonal antibody (M01), clone 5B12 (Cat # H00003753-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
(2 Publications)
Species: Ca, Gp, Hu, Pm, Rt
Applications: ELISA, ICC/IF, KD, WB
SC5DL Antibody
NBP2-55973
Western Blot: SC5DL Antibody [NBP2-55973] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/Immunofluorescence: SC5DL Antibody [NBP2-55973] - Staining of human cell line HaCaT shows localization to nucleus, cytosol & endoplasmic reticulum. Antibody staining is shown in green.
Species: Hu
Applications: ICC/IF, WB
SQLE Antibody
NBP2-32005
Western Blot: SQLE Antibody [NBP2-32005] - Analysis in human cell line MCF-7 and human cell line U-251 MG.
Immunohistochemistry-Paraffin: SQLE Antibody [NBP2-32005] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: SQLE Antibody [NBP2-32005] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Species: Hu
Applications: IHC, IHC-P, WB
MiRP1 Antibody
NBP2-38146
Immunohistochemistry: MiRP1 Antibody [NBP2-38146] - Staining of human stomach shows strong cytoplasmic positivity in subset of glandular cells.
Immunohistochemistry-Paraffin: MiRP1 Antibody [NBP2-38146] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: MiRP1 Antibody [NBP2-38146] - Staining in human stomach and liver tissues using anti-KCNE2 antibody. Corresponding KCNE2 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P
Kv1.5 Antibody
NBP2-76939
Western Blot: Kv1.5 Antibody [NBP2-76939] - Western blot analysis of KCNA5 on PANC-1 cell lysate using anti-KCNA5 antibody at 1:5000 dilution.
Immunocytochemistry/Immunofluorescence: Kv1.5 Antibody [NBP2-76939] - ICC staining KCNA5 in LOVO cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X-100, PBS.
Immunocytochemistry/Immunofluorescence: Kv1.5 Antibody [NBP2-76939] - ICC staining KCNA5 in SKOV-3 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X-100, PBS.
(1 Review)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Nav1.5 Antibody
(4G8:1G7)
NB110-61010
Flow Cytometry: Nav1.5 Antibody (4G8:1G7) [NB110-61010] - An intracellular stain was performed on MG-63 cells with Nav1.5 Antibody [4G8:1G7] NB110-61010PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Phycoerythrin.
Flow Cytometry: Nav1.5 Antibody (4G8:1G7) [NB110-61010] - An intracellular stain was performed on U2OS cells with Nav1.5 Antibody [4G8:1G7] NB110-61010PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Phycoerythrin.
Immunocytochemistry/Immunofluorescence: Nav1.5 Antibody (4G8-1G7) [NB110-61010] - Figure A: Plasma membrane localisation of Nav1.5 identified by 4G8:1G7 detected by anti-mouse Alexa Fluor-488 conjugated antibody; Figure B, DAP1 co-staining of cell nuclei
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IP, RIA, WB
MAP4K6 Antibody
NBP1-22990
Western Blot: MAP4K6 Antibody [NBP1-22990] - Wole cell lysate from HeLa and mouse NIH3T3 cells at 0.04 mcg/ml (A) and 1 mcg/ml (B) and used for IP at 3 mcg/mg lysate.
(5 Publications)
Species: Hu, Mu
Applications: IP, WB
OXSM Antibody
NBP1-84732
Western Blot: OXSM Antibody [NBP1-84732] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunohistochemistry-Paraffin: OXSM Antibody [NBP1-84732] - Staining of human cerebral cortex, kidney, lymph node and testis using Anti-OXSM antibody NBP1-84732 (A) shows similar protein distribution across tissues to independent antibody NBP1-84730 (B).
Immunohistochemistry-Paraffin: OXSM Antibody [NBP1-84732] - Staining of human kidney.
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Endostatin [HRP]
DNST0
(22 Publications)
Species: Hu
Applications: ELISA
KCNH1 Antibody
NBP1-84935
Immunohistochemistry-Paraffin: KCNH1 Antibody [NBP1-84935] - Analysis in human cerebral cortex and liver tissues. Corresponding KCNH1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: KCNH1 Antibody [NBP1-84935] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.
Immunohistochemistry-Paraffin: KCNH1 Antibody [NBP1-84935] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.
Species: Hu
Applications: IHC, IHC-P
Kv1.4 Antibody
NBP2-75552
Flow Cytometry: Kv1.4 Antibody [NBP2-75552] - Analysis of SH-SY5Y cells with Kv1.4 antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Immunocytochemistry/Immunofluorescence: Kv1.4 Antibody [NBP2-75552] - Staining Kv1.4 in SH-SY5Y cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: Kv1.4 Antibody [NBP2-75552] - Staining Kv1.4 in N2A cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-P, WB
KCNK3 Antibody
(S374-48)
NBP2-42202
Western Blot: KCNK3 Antibody (S374-48) [NBP2-42202] - Western Blot analysis of Rat Brain Membrane showing detection of ~50 kDa TASK1 Potassium Channel protein using Mouse Anti-TASK1 Potassium Channel Monoclonal Antibody, Clone S374-48 (NBP2-42202). Lane 1: Molecular Weight Ladder (MW). Lane 2: Rat brain membrane. Load: 15 ug. Block: 2% BSA and 2% Skim Milk in 1X TBST. Primary Antibody: Mouse Anti-TASK1 Potassium Channel Monoclonal Antibody (NBP2-42202) at 1:1000 for 16 hours at 4C. Secondary Antibody: Goat Anti-Mouse IgG: HRP at 1:2000 for 60 min at RT. Color Development: ECL solution for 6 min at RT. Predicted/Observed Size: ~50 kDa.
Immunocytochemistry/Immunofluorescence: KCNK3 Antibody (S374-48) [NBP2-42202] - Immunocytochemistry/Immunofluorescence analysis using Mouse Anti-TASK1 Potassium Channel Monoclonal Antibody, Clone S374-48 (NBP2-42202). Tissue: Neuroblastoma cell line (SK-N-BE). Species: Human. Fixation: 4% Formaldehyde for 15 min at RT. Primary Antibody: Mouse Anti-TASK1 Potassium Channel Monoclonal Antibody (NBP2-42202) at 1:100 for 60 min at RT. Secondary Antibody: Goat Anti-Mouse ATTO 488 at 1:100 for 60 min at RT. Counterstain: Phalloidin Texas Red F-Actin stain; DAPI (blue) nuclear stain at 1:1000, 1:5000 for 60min RT, 5min RT. Localization: Membrane. Magnification: 60X. (A) DAPI (blue) nuclear stain. (B) Phalloidin Texas Red F-Actin stain. (C) TASK1 Potassium Channel Antibody. (D) Composite.
Immunocytochemistry/Immunofluorescence: KCNK3 Antibody (S374-48) [NBP2-42202] - Immunocytochemistry/Immunofluorescence analysis using Mouse Anti-TASK1 Potassium Channel Monoclonal Antibody, Clone S374-48 (NBP2-42202). Tissue: Neuroblastoma cells (SH-SY5Y). Species: Human. Fixation: 4% PFA for 15 min. Primary Antibody: Mouse Anti-TASK1 Potassium Channel Monoclonal Antibody (NBP2-42202) at 1:50 for overnight at 4C with slow rocking. Secondary Antibody: AlexaFluor 488 at 1:1000 for 1 hour at RT. Counterstain: Phalloidin-iFluor 647 (red) F-Actin stain; Hoechst (blue) nuclear stain at 1:800, 1.6mM for 20 min at RT. (A) Hoechst (blue) nuclear stain. (B) Phalloidin-iFluor 647 (red) F-Actin stain. (C) TASK1 Potassium Channel Antibody (D) Composite.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Thyrotropin
Releasing Hormone Ant
NBP2-94348
Western Blot: Thyrotropin Releasing Hormone Antibody [NBP2-94348] - Analysis of extracts of various cell lines, using Thyrotropin Releasing Hormone at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 90s.
Immunocytochemistry/Immunofluorescence: Thyrotropin Releasing Hormone Antibody [NBP2-94348] - Analysis of U2OS cells using TRH Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunocytochemistry/Immunofluorescence: Thyrotropin Releasing Hormone Antibody [NBP2-94348] - Analysis of L929 cells using TRH Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
EphA3
640-A3
EphA3
(6 Publications)
Species: Mu
Applications: Bind
EGR2 Antibody -
BSA Free
NB110-59723
Immunocytochemistry/Immunofluorescence: EGR2 Antibody [NB110-59723] - MCF7 cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.5% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-EGR2 Antibody NB110-59723 at 2 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective and digitally deconvolved.
Immunohistochemistry-Paraffin: EGR2 Antibody [NB110-59723] - Analysis of a FFPE tissue section of mouse brain using 1:200 dilution of EGR2 antibody. The staining was developed using HRP labeled anti-rabbit secondary antibody and DAB reagent, and nuclei of cells were counter-stained with hematoxylin.
Western Blot: EGR2 Antibody [NB110-59723] - Detection of EGR2 in human fetal lung tissue using NB110-59723.
(1 Review)
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-P, WB
Kv4.3 Antibody
NBP2-76945
Western Blot: Kv4.3 Antibody [NBP2-76945] - Western blot analysis of Kv4.3 on different lysates using anti-Kv4.3 antibody at 1/1,000 dilution.Positive control:Lane1: MCF-7 Lane2: Mouse marrow
Immunocytochemistry/Immunofluorescence: Kv4.3 Antibody [NBP2-76945] - ICC staining Kv4.3 in LOVO cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: Kv4.3 Antibody [NBP2-76945] - ICC staining Kv4.3 in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB

Publications for Kv11.2 Antibody (NBP2-84127) (0)

There are no publications for Kv11.2 Antibody (NBP2-84127).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kv11.2 Antibody (NBP2-84127) (0)

There are no reviews for Kv11.2 Antibody (NBP2-84127). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Kv11.2 Antibody (NBP2-84127) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Kv11.2 Products

Bioinformatics Tool for Kv11.2 Antibody (NBP2-84127)

Discover related pathways, diseases and genes to Kv11.2 Antibody (NBP2-84127). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kv11.2 Antibody (NBP2-84127)

Discover more about diseases related to Kv11.2 Antibody (NBP2-84127).
 

Pathways for Kv11.2 Antibody (NBP2-84127)

View related products by pathway.

PTMs for Kv11.2 Antibody (NBP2-84127)

Learn more about PTMs related to Kv11.2 Antibody (NBP2-84127).
 

Research Areas for Kv11.2 Antibody (NBP2-84127)

Find related products by research area.

Blogs on Kv11.2

There are no specific blogs for Kv11.2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Kv11.2 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol KCNH6