Kv10.2 Antibody


Immunohistochemistry-Paraffin: Kv10.2 Antibody [NBP1-84934] - Staining of human skeletal muscle shows distinct cytoplasmic positivity in myocytes.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

Kv10.2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: GDYEVIDEVTNTIQIDSWLYQLALSIGTPYRYNTSAGIWEGGPSKDS
Specificity of human Kv10.2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Kv10.2 Protein (NBP1-84934PEP)
Read Publication using NBP1-84934.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22855790)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Kv10.2 Antibody

  • hEAG2
  • potassium channel HEAG2
  • potassium voltage-gated channel, subfamily H (eag-related), member 5
  • voltage-gated potassium channel subunit Kv10.2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Av
Applications: WB, EIA, Flow, IHC, IHC-Fr, IHC-P, IF
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for Kv10.2 Antibody (NBP1-84934)(1)

Reviews for Kv10.2 Antibody (NBP1-84934) (0)

There are no reviews for Kv10.2 Antibody (NBP1-84934). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Kv10.2 Antibody (NBP1-84934) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for Kv10.2 Antibody (NBP1-84934)

Discover related pathways, diseases and genes to Kv10.2 Antibody (NBP1-84934). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kv10.2 Antibody (NBP1-84934)

Discover more about diseases related to Kv10.2 Antibody (NBP1-84934).

Pathways for Kv10.2 Antibody (NBP1-84934)

View related products by pathway.

PTMs for Kv10.2 Antibody (NBP1-84934)

Learn more about PTMs related to Kv10.2 Antibody (NBP1-84934).

Research Areas for Kv10.2 Antibody (NBP1-84934)

Find related products by research area.

Blogs on Kv10.2

There are no specific blogs for Kv10.2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Kv10.2 Antibody and receive a gift card or discount.


Gene Symbol KCNH5