KPNA5 Antibody - BSA Free

Immunohistochemistry-Paraffin: KPNA5 Antibody [NBP2-38715] - Staining in human testis and endometrium tissues using anti-KPNA5 antibody. Corresponding KPNA5 RNA-seq data are presented for the same tissues.

Immunocytochemistry/Immunofluorescence: KPNA5 Antibody [NBP2-38715] - Staining of human cell line U-251 MG shows localization to cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: KPNA5 Antibody [NBP2-38715] - Staining of human endometrium shows low expression as expected.

Immunohistochemistry-Paraffin: KPNA5 Antibody [NBP2-38715] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

KPNA5 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit KPNA5 Antibody - BSA Free (NBP2-38715) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KRRNVYLPRNDESMLESPIQDPDISSTVPIPEEEVVTTDMVQMIFSNNADQQLTATQK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KPNA5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  KPNA5 Protein (NBP2-38715PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (83%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for KPNA5 Antibody - BSA Free

• importin alpha 6
• importin subunit alpha-6
• IPOA6
• karyopherin alpha 5 (importin alpha 6)
• Karyopherin subunit alpha-5
• SRP6

Background

The transport of molecules between the nucleus and the cytoplasm in eukaryotic cells is mediated by the nuclear pore complex (NPC) which consists of 60-100 proteins and is probably 120 million daltons in molecular size. Small molecules (up to 70 kD) can pass through the nuclear pore by nonselective diffusion; larger molecules are transported by an active process. Most nuclear proteins contain short basic amino acid sequences known as nuclear localization signals (NLSs). KPNA5 protein belongs to the importin alpha protein family and is thought to be involved in NLS-dependent protein import into the nucleus.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KPNA5
• Uniprot:
  • O15131(Human)