KPNA5 Antibody


Immunocytochemistry/ Immunofluorescence: KPNA5 Antibody [NBP2-38715] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
Immunohistochemistry-Paraffin: KPNA5 Antibody [NBP2-38715] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry: KPNA5 Antibody [NBP2-38715] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.
Immunohistochemistry-Paraffin: KPNA5 Antibody [NBP2-38715] - Staining in human testis and endometrium tissues using anti-KPNA5 antibody. Corresponding KPNA5 RNA-seq data are presented for the same tissues.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

KPNA5 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: KRRNVYLPRNDESMLESPIQDPDISSTVPIPEEEVVTTDMVQMIFSNNADQQLTATQK
Specificity of human KPNA5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
KPNA5 Protein (NBP2-38715PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (83%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for KPNA5 Antibody

  • importin alpha 6
  • importin subunit alpha-6
  • IPOA6
  • karyopherin alpha 5 (importin alpha 6)
  • Karyopherin subunit alpha-5
  • SRP6


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
Species: Hu
Species: Hu
Applications: IHC
Species: Hu
Applications: ICC/IF
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Po, Ca, Eq, Pm
Applications: WB
Species: Hu, Mu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Rt
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for KPNA5 Antibody (NBP2-38715) (0)

There are no publications for KPNA5 Antibody (NBP2-38715).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KPNA5 Antibody (NBP2-38715) (0)

There are no reviews for KPNA5 Antibody (NBP2-38715). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for KPNA5 Antibody (NBP2-38715) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for KPNA5 Antibody (NBP2-38715)

Discover related pathways, diseases and genes to KPNA5 Antibody (NBP2-38715). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KPNA5 Antibody (NBP2-38715)

Discover more about diseases related to KPNA5 Antibody (NBP2-38715).

Blogs on KPNA5

There are no specific blogs for KPNA5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our KPNA5 Antibody and receive a gift card or discount.


Gene Symbol KPNA5