KPNA3 Antibody


Western Blot: KPNA3 Antibody [NBP1-52976] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.
Western Blot: KPNA3 Antibody [NBP1-52976] - HepG2.
Western Blot: KPNA3 Antibody [NBP1-52976] - Hela.
Western Blot: KPNA3 Antibody [NBP1-52976] - Human Fetal Lung.
Western Blot: KPNA3 Antibody [NBP1-52976] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.
Tissue Culture Substratum: KPNA3 Antibody [NBP1-52976] - Human Fetal Brain.

Product Details

Reactivity HuSpecies Glossary
Applications WB, TCS

Order Details

KPNA3 Antibody Summary

Synthetic peptides corresponding to KPNA3(karyopherin alpha 3 (importin alpha 4)) The peptide sequence was selected from the N terminal of KPNA3. Peptide sequence AENPSLENHRIKSFKNKGRDVETMRRHRNEVTVELRKNKRDEHLLKKRNV.
This product is specific to Subunit or Isoform: alpha-3.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Tissue Culture Substratum
Application Notes
This is a rabbit polyclonal antibody against KPNA3 and was validated on Western blot.
Theoretical MW
58 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified
Reconstitution Instructions
Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1mg/ml. Vortex followed by Centrifuge again to pellet the solution.


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for KPNA3 Antibody

  • hSRP1
  • importin alpha 4
  • Importin alpha Q2
  • importin alpha-3
  • importin subunit alpha-3
  • importin-alpha-Q2
  • IPOA4
  • karyopherin alpha 3 (importin alpha 4)
  • Karyopherin subunit alpha-3
  • qip2
  • SRP1
  • SRP1gamma
  • SRP1-gamma
  • SRP4


The transport of molecules between the nucleus and the cytoplasm in eukaryotic cells is mediated by the nuclear pore complex (NPC) which consists of 60-100 proteins and is probably 120 million daltons in molecular size. Small molecules (up to 70 kD) can pass through the nuclear pore by nonselective diffusion; larger molecules are transported by an active process. Most nuclear proteins contain short basic amino acid sequences known as nuclear localization signals (NLSs). KPNA3 is a protein similar to certain nuclear transport proteins of Xenopus and human. The predicted amino acid sequence shows similarity to Xenopus importin, yeast SRP1, and human RCH1 (KPNA2), respectively. The similarities among these proteins suggest that karyopherin alpha-3 may be involved in the nuclear transport system.The transport of molecules between the nucleus and the cytoplasm in eukaryotic cells is mediated by the nuclear pore complex (NPC) which consists of 60-100 proteins and is probably 120 million daltons in molecular size. Small molecules (up to 70 kD) can pass through the nuclear pore by nonselective diffusion; larger molecules are transported by an active process. Most nuclear proteins contain short basic amino acid sequences known as nuclear localization signals (NLSs). KPNA3, encodes a protein similar to certain nuclear transport proteins of Xenopus and human. The predicted amino acid sequence shows similarity to Xenopus importin, yeast SRP1, and human RCH1 (KPNA2), respectively. The similarities among these proteins suggests that karyopherin alpha-3 may be involved in the nuclear transport system. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Mu
Applications: WB, ChIP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, ChHa, Pm
Applications: WB, EM, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, IP

Publications for KPNA3 Antibody (NBP1-52976) (0)

There are no publications for KPNA3 Antibody (NBP1-52976).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KPNA3 Antibody (NBP1-52976) (0)

There are no reviews for KPNA3 Antibody (NBP1-52976). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KPNA3 Antibody (NBP1-52976) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional KPNA3 Products

Bioinformatics Tool for KPNA3 Antibody (NBP1-52976)

Discover related pathways, diseases and genes to KPNA3 Antibody (NBP1-52976). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KPNA3 Antibody (NBP1-52976)

Discover more about diseases related to KPNA3 Antibody (NBP1-52976).

Pathways for KPNA3 Antibody (NBP1-52976)

View related products by pathway.

PTMs for KPNA3 Antibody (NBP1-52976)

Learn more about PTMs related to KPNA3 Antibody (NBP1-52976).

Blogs on KPNA3

There are no specific blogs for KPNA3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our KPNA3 Antibody and receive a gift card or discount.


Gene Symbol KPNA3