Recombinant Human KNTC1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human KNTC1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 2100-2209 of Human KNTC1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:DPQVILKQLEEHMNTGQLAGFSHQIRSLILNNIINKKEFGILAKTKYFQMLKMHAMNTNNITELVNYLANDLSLDEASVLITEYSKHCGKPVPPDTAPCEILKMFLSGLS

Protein/Peptide Type
Partial Recombinant Protein
Gene
KNTC1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human KNTC1 Protein

  • FLJ36151
  • hRod
  • hsROD
  • KIAA0166Rough Deal homolog, centromere/kinetochore protein
  • kinetochore associated 1
  • kinetochore-associated protein 1
  • Rod
  • RODHsROD
  • Rough deal homolog

Background

KNTC1 - kinetochore associated 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-35213
Species: Hu
NBP1-86713
Species: Hu
Applications: IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-38644
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB172
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
NB100-56505
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NBP2-21057
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NBP2-02487
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-89134
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-42378
Species: Hu
Applications: WB, IHC
NB110-3638
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
H00006241-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP1-76775
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for KNTC1 Partial Recombinant Protein (H00009735-Q01) (0)

There are no publications for KNTC1 Partial Recombinant Protein (H00009735-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KNTC1 Partial Recombinant Protein (H00009735-Q01) (0)

There are no reviews for KNTC1 Partial Recombinant Protein (H00009735-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KNTC1 Partial Recombinant Protein (H00009735-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional KNTC1 Products

Bioinformatics Tool for KNTC1 Partial Recombinant Protein (H00009735-Q01)

Discover related pathways, diseases and genes to KNTC1 Partial Recombinant Protein (H00009735-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KNTC1 Partial Recombinant Protein (H00009735-Q01)

Discover more about diseases related to KNTC1 Partial Recombinant Protein (H00009735-Q01).
 

Pathways for KNTC1 Partial Recombinant Protein (H00009735-Q01)

View related products by pathway.

Research Areas for KNTC1 Partial Recombinant Protein (H00009735-Q01)

Find related products by research area.

Blogs on KNTC1

There are no specific blogs for KNTC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

KNTC1 Antibody (10H4)
H00009735-M01
CD4 Antibody
NBP1-19371

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human KNTC1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol KNTC1