KMT2B Antibody - BSA Free

Western Blot: KMT2B Antibody [NBP2-82270] - WB Suggested Anti-MLL4 Antibody Titration: 5ug/ml. Positive Control: HepG2 cell lysateKMT2B is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells

Western Blot: KMT2B Antibody [NBP2-82270] - Host: Rabbit. Target Name: MLL4. Sample Tissue: Human THP-1 Whole Cell. Antibody Dilution: 1ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

KMT2B Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit KMT2B Antibody - BSA Free (NBP2-82270) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KMT2B. Peptide sequence: WAGPRVQRGRGRGRGRGWGPSRGCVPEEESSDGESDEEEFQGFHSDEDVA The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KMT2B
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 64 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for KMT2B Antibody - BSA Free

• EC 2.1.1.43
• histone-lysine N-methyltransferase MLL4
• HRX2
• KIAA0304WW domain-binding protein 7
• Lysine N-methyltransferase 2D
• mixed lineage leukemia gene homolog 2
• MLL2
• myeloid/lymphoid or mixed-lineage leukemia 4
• Myeloid/lymphoid or mixed-lineage leukemia protein 4
• Trithorax homolog 2
• trithorax homologue 2
• TRX2
• WBP7
• WBP-7
• WW domain binding protein 7

Background

MLL4 encodes a protein which contains multiple domains including a CXXC zinc finger, three PHD zinc fingers, two FY-rich domains, and a SET (suppressor of variegation, enhancer of zeste, and trithorax) domain. The SET domain is a conserved C-terminal domain that characterizes proteins of the MLL (mixed-lineage leukemia) family. This gene is ubiquitously expressed in adult tissues. It is also amplified in solid tumor cell lines, and may be involved in human cancer. Two alternatively spliced transcript variants encoding distinct isoforms have been reported for this gene, however, the full length nature of the shorter transcript is not known.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KMT2B