![Immunocytochemistry/Immunofluorescence: KLHL35 Antibody [NBP1-89837] - Staining of human cell line SiHa shows localization to nucleus, nucleoli fibrillar center & centrosome.](http://images.novusbio.com/fullsize/KLHL35-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89837-img0006.jpg "Immunocytochemistry/Immunofluorescence: KLHL35 Antibody [NBP1-89837] - Staining of human cell line SiHa shows localization to nucleus, nucleoli fibrillar center & centrosome.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit KLHL35 Antibody - BSA Free (NBP1-89837) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-KLHL35 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KLFVIGGARQGGVNTDKVQCFDPKEDRWSLRSPAPFSQRCLEAVSLEDTIYVMGGLMSKIFT |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | KLHL35 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Publication using NBP1-89837 | Applications | Species |
|---|---|---|
| Chatterjee S, Kang SD, Alam S et al. Tissue-specific gene expression during productive HPV16 infection of cervical, foreskin and tonsil epithelium J. Virol. 2019-06-12 [PMID: 31189705] |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | KLHL35 |
![Immunohistochemistry-Paraffin: KLHL35 Antibody [NBP1-89837] - Staining of human kidney shows strong membranous positivity in glomeruli.](http://images.novusbio.com/fullsize/KLHL35-Antibody-Immunohistochemistry-Paraffin-NBP1-89837-img0002.jpg "Immunohistochemistry-Paraffin: KLHL35 Antibody [NBP1-89837] - Staining of human kidney shows strong membranous positivity in glomeruli.")
![Immunohistochemistry MCAM/CD146 Antibody [Unconjugated]](https://images.novusbio.com/images2/MCAM_AF932_Immunohistochemistry_21266.jpg)
![Western Blot MCAM/CD146 Antibody [Unconjugated]](https://images.novusbio.com/images2/MCAM_AF932_Western_Blot_16697.jpg)
![Immunohistochemistry MCAM/CD146 Antibody [Unconjugated]](https://images.novusbio.com/images2/MCAM_AF932_Immunohistochemistry_7216.jpg)
![Flow Cytometry Pax5/BSAP Antibody (1207C) [Unconjugated]](https://images.novusbio.com/images2/Pax5_MAB3487_Flow_Cytometry_19328.jpg)
![Western Blot Pax5/BSAP Antibody (1207C) [Unconjugated]](https://images.novusbio.com/images2/Pax5_MAB3487_Western_Blot_19363.jpg)
![Immunohistochemistry Pax5/BSAP Antibody (1207C) [Unconjugated]](https://images.novusbio.com/images2/Pax5_MAB3487_Immunohistochemistry_19379.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")