KLHL2 Antibody (3G3) - Azide and BSA Free Summary
| Description |
Novus Biologicals Mouse KLHL2 Antibody (3G3) - Azide and BSA Free (H00011275-M01) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
KLHL2 (NP_009177.2, 1 a.a. ~ 66 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. METPPLPPACTKQGHQKPLDSKDDNTEKHCPVTVNPWHMKKAFKVMNELRSQNLLCDVTIVAEDME |
| Specificity |
KLHL2 - kelch-like 2, Mayven (Drosophila) (3G3) |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
KLHL2 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Sandwich ELISA
- Western Blot 1:500
|
| Application Notes |
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for KLHL2 Antibody (3G3) - Azide and BSA Free
Background
KLHL2, also known as Kelch-like protein 2, has a 593 short amino acid that is 66 kDa and a long 597 amino acid that is 67 kDa, predominantly expressed in brain, and may participate in organizing the actin cytoskeleton of the brain cells. This protein is currently being studied for research on the following diseases and disorders: contagious pustular dermatitis, lumpy skin disease, monkeypox, smallpox, cowpox, vaccinia, skin disease, dermatitis, pharyngitis, breast cancer, and neuronitis. The protein has been shown to interact with KLHL12 in intracellular protein transport pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Al, Av, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, Flow, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
Species: Hu, Mu, Rt
Applications: KO, Simple Western, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, Flow, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC, IHC-P, MI, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P, IP, WB (-)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt
Applications: Block, CyTOF-ready, Flow, IHC, WB
Species: Hu
Applications: WB, ELISA
Publications for KLHL2 Antibody (H00011275-M01) (0)
There are no publications for KLHL2 Antibody (H00011275-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for KLHL2 Antibody (H00011275-M01) (0)
There are no reviews for KLHL2 Antibody (H00011275-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for KLHL2 Antibody (H00011275-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional KLHL2 Products
Blogs on KLHL2