KLHDC2 Antibody

Western Blot: KLHDC2 Antibody [NBP2-85159] - Host: Rabbit. Target Name: KLDC2. Sample Type: Lymph Node Tumor lysates. Antibody Dilution: 1.0ug/ml

Product Discontinued

KLHDC2 Antibody Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human KLHDC2. Peptide sequence: FSVQPKSLVRLSLEAVICFKEMLANSWNCLPKHLLHSVNQRFGSNNTSGS The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KLHDC2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for KLHDC2 Antibody

• HCA33
• HCLP-1Host cell factor-like protein 1
• Hepatocellular carcinoma-associated antigen 33
• Host cell factor homolog LCP
• kelch domain containing 2
• kelch domain-containing protein 2
• KLHDC2
• LCP

Background

KLHDC2, also known as Kelch domain-containing protein 2, is a 46kDa 406 amino acid protein with a shorter 28kDa 249 isoform produced by alternative splicing. KLHDC2 interfers with CREB3-DNA binding by repressing CREB3-mediated transcription. Current research is being conducted on KLHDC2 in relation to Legg-Calve-Perthes disease, hepatocellular carcinoma and herpes simplex. KLHDC2 is linked to the reflex, excretion, micturition, cytokine production and lactation pathways where it interacts with DDX19B, SFN, STRN4, EZH2 and UBXN7.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KLHDC2