KLHDC2 Antibody Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human KLHDC2. Peptide sequence: FSVQPKSLVRLSLEAVICFKEMLANSWNCLPKHLLHSVNQRFGSNNTSGS The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
KLHDC2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for KLHDC2 Antibody
Background
KLHDC2, also known as Kelch domain-containing protein 2, is a 46kDa 406 amino acid protein with a shorter 28kDa 249 isoform produced by alternative splicing. KLHDC2 interfers with CREB3-DNA binding by repressing CREB3-mediated transcription. Current research is being conducted on KLHDC2 in relation to Legg-Calve-Perthes disease, hepatocellular carcinoma and herpes simplex. KLHDC2 is linked to the reflex, excretion, micturition, cytokine production and lactation pathways where it interacts with DDX19B, SFN, STRN4, EZH2 and UBXN7.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: ELISA, IHC, IHC-P, KD, S-ELISA, WB
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: Bind
Species: Hu
Applications: IP, KD, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu, Rt
Applications: ICC, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: ICC, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: IP, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Publications for KLHDC2 Antibody (NBP2-85159) (0)
There are no publications for KLHDC2 Antibody (NBP2-85159).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for KLHDC2 Antibody (NBP2-85159) (0)
There are no reviews for KLHDC2 Antibody (NBP2-85159).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for KLHDC2 Antibody (NBP2-85159) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional KLHDC2 Products
Blogs on KLHDC2