KLF5 Antibody (2G12)

Images

 
Western Blot: KLF5 Antibody (2G12) [H00000688-M01] - KLF5 monoclonal antibody (M01), clone 2G12. Analysis of KLF5 expression in HeLa.
Sandwich ELISA: KLF5 Antibody (2G12) [H00000688-M01] - Detection limit for recombinant GST tagged KLF5 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
2G12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

KLF5 Antibody (2G12) Summary

Immunogen
KLF5 (NP_001721, 358 a.a. ~ 457 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RYNRRSNPDLEKRRIHYCDYPGCTKVYTKSSHLKAHLRTHTGEKPYKCTWEGCDWRFARSDELTRHYRKHTGAKPFQCGVCNRSFSRSDHLALHMKRHQN
Specificity
KLF5 - Kruppel-like factor 5 (intestinal) (2G12)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
KLF5
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for KLF5 Antibody (2G12)

  • Basic transcription element-binding protein 2
  • BTEB2
  • BTE-binding protein 2
  • CKLFGC-box-binding protein 2
  • Colon krueppel-like factor
  • colon kruppel-like factor
  • GC box binding protein 2
  • IKLFbasic transcription element binding protein 2
  • Intestinal-enriched krueppel-like factor
  • intestinal-enriched kruppel-like factor
  • KLF5
  • Krueppel-like factor 5
  • Kruppel-like factor 5 (intestinal)
  • Transcription factor BTEB2

Background

This gene encodes a member of the Kruppel-like factor subfamily of zinc finger proteins. Since the protein localizes to the nucleus and binds the epidermal growth factor response element, it is thought to be a transcription factor. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3158
Species: Mu
Applications: ChIP, ICC, IHC, WB
H00001958-M03
Species: Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB600-232
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
MAB5466
Species: Hu
Applications: CyTOF-ready, ICC, ICFlow
NBP2-01223
Species: Hu
Applications: Flow, IHC, IHC-P, WB
DPSG10
Species: Hu
Applications: ELISA
NBP1-30027
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67635
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IP, WB
NBP2-32840
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-45511
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
221-AA
Species: Hu
Applications: BA
NB200-322
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
AF231
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NBP2-37380
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB

Publications for KLF5 Antibody (H00000688-M01) (0)

There are no publications for KLF5 Antibody (H00000688-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KLF5 Antibody (H00000688-M01) (0)

There are no reviews for KLF5 Antibody (H00000688-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KLF5 Antibody (H00000688-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KLF5 Products

Bioinformatics Tool for KLF5 Antibody (H00000688-M01)

Discover related pathways, diseases and genes to KLF5 Antibody (H00000688-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KLF5 Antibody (H00000688-M01)

Discover more about diseases related to KLF5 Antibody (H00000688-M01).
 

Pathways for KLF5 Antibody (H00000688-M01)

View related products by pathway.

PTMs for KLF5 Antibody (H00000688-M01)

Learn more about PTMs related to KLF5 Antibody (H00000688-M01).
 

Research Areas for KLF5 Antibody (H00000688-M01)

Find related products by research area.

Blogs on KLF5.

KLF4 as a transcription factor in stem cell differentiation
Kru¨ppel-like factors (KLFs) are evolutionarily conserved zinc finger transcription factors that play a role in cell differentiation, proliferation, and pluripotency. KLF4 has specifically been tied to many diverse cellular processes, including sel...  Read full blog post.

Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KLF5 Antibody (2G12) and receive a gift card or discount.

Bioinformatics

Gene Symbol KLF5
Entrez
Uniprot