KLF11 Antibody (8F4) - Azide and BSA Free Summary
| Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen |
KLF11 (NP_003588, 404 a.a. ~ 512 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TYFKSSHLKAHLRTHTGEKPFNCSWDGCDKKFARSDELSRHRRTHTGEKKFVCPVCDRRFMRSDHLTKHARRHMTTKKIPGWQAEVGKLNRIASAESPGSPLVSMPASA |
| Specificity |
KLF11 - Kruppel-like factor 11 |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
KLF11 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Western Blot
|
| Application Notes |
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA. |
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for KLF11 Antibody (8F4) - Azide and BSA Free
Background
Transcription factor. Activates the epsilon- and gamma-globin gene promoters and, to a much lower degree, the beta-globin gene and represses promoters containing SP1-like binding inhibiting cell growth. Represses transcription of SMAD7 which enhances TGF-beta signaling. Induces apoptosis
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow
Species: Ca, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: ChIP, ICC, IHC, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC, KO, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, ICC, ICFlow
Publications for KLF11 Antibody (H00008462-M01)(5)
Showing Publications 1 -
5 of 5.
| Publications using H00008462-M01 |
Applications |
Species |
| Wenying L, Haocheng L, Jinjian S et al. KLF11 Protects against Venous Thrombosis via Suppressing Tissue Factor Expression. Thromb Haemost. 2021-08-24 [PMID: 34428834] |
|
|
| Qiao C, Li S, Lu H et al. Laminar Flow Attenuates Macrophage Migration Inhibitory Factor Expression in Endothelial Cells. Sci Rep 2018-02-05 [PMID: 29403061] |
|
|
| Zheng Y, Khan Z, Zanfagnin V et al. Epigenetic Modulation of Collagen 1A1: Therapeutic Implications in Fibrosis and Endometriosis. Biol Reprod 2016-04-01 [PMID: 26935598] |
|
|
| Zheng Y, Tabbaa ZM, Khan Z et al. Epigenetic Regulation of Uterine Biology by Transcription Factor KLF11 via Post-translational Histone Deacetylation of Cytochrome p450 Metabolic Enzymes. Endocrinology. 2014-04-25 [PMID: 25076120] |
|
|
| Daftary GS, Zheng Y, Tabbaa ZM et al. A Novel Role of the Sp/KLF Transcription Factor KLF11 in Arresting Progression of Endometriosis. PLoS One. 2013-03-28 [PMID: 23555910] |
|
|
Reviews for KLF11 Antibody (H00008462-M01) (0)
There are no reviews for KLF11 Antibody (H00008462-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for KLF11 Antibody (H00008462-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional KLF11 Products
Research Areas for KLF11 Antibody (H00008462-M01)
Find related products by research area.
|
Blogs on KLF11