KLF1 Antibody

Immunohistochemistry-Paraffin: KLF1 Antibody [NBP2-49023] - Staining in human bone marrow and cerebral cortex tissues using anti-KLF1 antibody. Corresponding KLF1 RNA-seq data are presented for the same tissues.

Immunocytochemistry/Immunofluorescence: KLF1 Antibody [NBP2-49023] - Staining of human cell line HEL shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: KLF1 Antibody [NBP2-49023] - Staining of human bone marrow shows high expression.

Immunohistochemistry-Paraffin: KLF1 Antibody [NBP2-49023] - Staining of human cerebral cortex shows low expression as expected.

Product Discontinued

KLF1 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LALQPVYPGPGAGSSGGYFPRTGLSVPAASGAPYGLLSGYPAMYPAPQYQGHFQLFRGLQGPAPGPATSPSFLSCLGPG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KLF1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation/Permeabilization: PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for KLF1 Antibody

• EKLFerythroid-specific transcription factor EKLF
• Erythroid krueppel-like transcription factor
• erythroid Kruppel-like factor
• HBFQTL6
• INLU
• Krueppel-like factor 1
• Kruppel-like factor 1 (erythroid)
• monoclonal A3D8

Background

The KLF1 gene encodes a hematopoietic-specific transcription factor that induces high-level expression of adult beta-globin and other erythroid genes. The zinc-finger protein binds to the DNA sequence CCACACCCT found in the beta hemoglobin promoter. Heterozyg

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KLF1