Kir6.2 Recombinant Protein Antigen

Images

 
There are currently no images for Kir6.2 Protein (NBP2-33540PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Kir6.2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KCNJ11.

Source: E. coli

Amino Acid Sequence: TVKVPTPLCTARQLDEDHSLLEALTLASARGPLRKRSVPMAKAKPKFSISPDSLS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KCNJ11
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33540.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Kir6.2 Recombinant Protein Antigen

  • ATP-sensitive inward rectifier potassium channel 11
  • beta-cell inward rectifier subunit
  • BIRKIR6.2
  • HHF2
  • IKATP
  • Inward rectifier K(+) channel Kir6.2
  • inwardly rectifying potassium channel KIR6.2
  • KCNJ11
  • Kir6.2
  • MGC133230
  • PHHI
  • potassium channel inwardly rectifing subfamily J member 11
  • Potassium channel, inwardly rectifying subfamily J member 11
  • potassium inwardly-rectifying channel, subfamily J, member 11
  • TNDM3

Background

Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. The encoded protein, which has a greater tendency to allow potassium to flow into a cell rather than out of a cell, is controlled by G-proteins and is found associated with the sulfonylurea receptor SUR. Mutations in this gene are a cause of familial persistent hyperinsulinemic hypoglycemia of infancy (PHHI), an autosomal recessive disorder characterized by unregulated insulin secretion. Defects in this gene may also contribute to autosomal dominant non-insulin-dependent diabetes mellitus type II (NIDDM), transient neonatal diabetes mellitus type 3 (TNDM3), and permanent neonatal diabetes mellitus (PNDM). [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-59320
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP2-59324
Species: Ma, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP1-47778
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-22403
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
H00006934-M06
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NB200-338
Species: Hu, Mu
Applications: IP, WB (-)
NBP1-58906
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
MAB1225
Species: Hu
Applications: Block, CyTOF-reported, Flow
NBP1-82874
Species: Hu
Applications: IHC,  IHC-P
NBP1-88584
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-89679
Species: Hu, Mu, Rt
Applications: ChIP-EXO-SEQ, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-33680
Species: Hu
Applications: IHC,  IHC-P
NBP3-25355
Species: Dr, Hu, Mu
Applications: IHC,  IHC-P, WB
AF4670
Species: Hu
Applications: CyTOF-ready, Flow, IHC, KO, Neut, WB
NBP2-14214
Species: Hu
Applications: IHC,  IHC-P
NBP2-33540PEP
Species: Hu
Applications: AC

Publications for Kir6.2 Protein (NBP2-33540PEP) (0)

There are no publications for Kir6.2 Protein (NBP2-33540PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kir6.2 Protein (NBP2-33540PEP) (0)

There are no reviews for Kir6.2 Protein (NBP2-33540PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Kir6.2 Protein (NBP2-33540PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Kir6.2 Products

Array NBP2-33540PEP

Research Areas for Kir6.2 Protein (NBP2-33540PEP)

Find related products by research area.

Blogs on Kir6.2

There are no specific blogs for Kir6.2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Kir6.2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNJ11