Kir6.1 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit Kir6.1 Antibody - BSA Free (NBP2-85158) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human Kir6.1. Peptide sequence: EKPSILIQTLQKSELSHQNSLRKRNSMRRNNSMRRNNSIRRNNSSLMVPK The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
KCNJ8 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for Kir6.1 Antibody - BSA Free
Background
The Kir6.1 (KCNJ8) gene is essential in membrane function as it encodes an inward-rectifier potassium channel protein that is 424 amino acids long and has a mass of nearly 48 kDA. Dysfunctions in the Kir6.1 gene may be a cause of J-wave syndromes and sudden infant death syndrome (SIDS). Research is investigating its role in various diseases such as retinitis, hypoxia, pancreatitis, myocardial infarction, spasticity, leiomyoma, acute myocardial infarction, and prinzmetal angina. The Kir6.1 gene plays a significant role in ATP sensitive potassium channels, SIDS susceptibility pathways, dopamine feedback into cAMP pathway, and the CFTR-dependent regulation of ion channels in airway epithelium. It interacts with other genes such as KCNJ2, ABCC8, ABCC9, and KCNJ11.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Mu
Applications: ChIP, IP, WB (-)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: Block, CyTOF-reported, Flow
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, MiAr, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: IHC, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Publications for Kir6.1 Antibody (NBP2-85158) (0)
There are no publications for Kir6.1 Antibody (NBP2-85158).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Kir6.1 Antibody (NBP2-85158) (0)
There are no reviews for Kir6.1 Antibody (NBP2-85158).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Kir6.1 Antibody (NBP2-85158) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Kir6.1 Products
Research Areas for Kir6.1 Antibody (NBP2-85158)
Find related products by research area.
|
Blogs on Kir6.1