Kir6.1 Antibody

Images

 
Western Blot: Kir6.1 Antibody [NBP2-85158] - WB Suggested Anti-KCNJ8 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Hela cell lysate

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
0.5 mg/ml

Order Details

Kir6.1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human Kir6.1. Peptide sequence: EKPSILIQTLQKSELSHQNSLRKRNSMRRNNSMRRNNSIRRNNSSLMVPK The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
KCNJ8
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for Kir6.1 Antibody

  • ATP-sensitive inward rectifier potassium channel 8
  • Inward rectifier K(+) channel Kir6.1
  • inwardly rectifying potassium channel KIR6.1
  • KCNJ8
  • Kir6.1
  • Potassium channel, inwardly rectifying subfamily J member 8
  • potassium inwardly-rectifying channel, subfamily J, member 8
  • uKATP-1

Background

The Kir6.1 (KCNJ8) gene is essential in membrane function as it encodes an inward-rectifier potassium channel protein that is 424 amino acids long and has a mass of nearly 48 kDA. Dysfunctions in the Kir6.1 gene may be a cause of J-wave syndromes and sudden infant death syndrome (SIDS). Research is investigating its role in various diseases such as retinitis, hypoxia, pancreatitis, myocardial infarction, spasticity, leiomyoma, acute myocardial infarction, and prinzmetal angina. The Kir6.1 gene plays a significant role in ATP sensitive potassium channels, SIDS susceptibility pathways, dopamine feedback into cAMP pathway, and the CFTR-dependent regulation of ion channels in airway epithelium. It interacts with other genes such as KCNJ2, ABCC8, ABCC9, and KCNJ11.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Kir6.1 Antibody (NBP2-85158) (0)

There are no publications for Kir6.1 Antibody (NBP2-85158).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kir6.1 Antibody (NBP2-85158) (0)

There are no reviews for Kir6.1 Antibody (NBP2-85158). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Kir6.1 Antibody (NBP2-85158) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Kir6.1 Products

Research Areas for Kir6.1 Antibody (NBP2-85158)

Find related products by research area.

Blogs on Kir6.1

There are no specific blogs for Kir6.1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Kir6.1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNJ8