KIF6 Recombinant Protein Antigen

Images

 
There are currently no images for KIF6 Protein (NBP1-86767PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

KIF6 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KIF6.

Source: E.coli

Amino Acid Sequence: NEAVLNEEINPRLVIKRLQKEIQELKDELAMVTGEQRTEALTEAELLQLEKLITSFLEDQDSDSRLEVGADMRKVHHCFHHL

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KIF6
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-86767.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for KIF6 Recombinant Protein Antigen

  • C6orf102
  • chromosome 6 open reading frame 102
  • dJ1043E3.1
  • dJ137F1.4
  • dJ188D3.1
  • DKFZp451I2418
  • kinesin family member 6
  • kinesin-like protein KIF6
  • MGC33317

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01064
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF5354
Species: Hu
Applications: WB, IHC
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
MAB1287
Species: Mu
Applications: WB
AF5739
Species: Hu, Mu, Rt
Applications: WB
NBP1-87894
Species: Hu
Applications: IHC, IHC-P
NBP1-19015
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, ICC/IF, IP
NBP2-56533
Species: Hu
Applications: ICC/IF
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45863
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-23610
Species: Hu
Applications: ICC/IF (-), WB, Flow, IHC
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP2-52979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-41263
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NBP2-01397
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-88370
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-05027
Species: Hu
NBP1-86767PEP
Species: Hu
Applications: AC

Publications for KIF6 Protein (NBP1-86767PEP) (0)

There are no publications for KIF6 Protein (NBP1-86767PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KIF6 Protein (NBP1-86767PEP) (0)

There are no reviews for KIF6 Protein (NBP1-86767PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for KIF6 Protein (NBP1-86767PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for KIF6 Protein (NBP1-86767PEP)

Discover related pathways, diseases and genes to KIF6 Protein (NBP1-86767PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KIF6 Protein (NBP1-86767PEP)

Discover more about diseases related to KIF6 Protein (NBP1-86767PEP).
 

Pathways for KIF6 Protein (NBP1-86767PEP)

View related products by pathway.

PTMs for KIF6 Protein (NBP1-86767PEP)

Learn more about PTMs related to KIF6 Protein (NBP1-86767PEP).

Blogs on KIF6

There are no specific blogs for KIF6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

KIF6 Antibody
NBP1-44066

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our KIF6 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol KIF6