KIF3B Antibody

Images

 
Western Blot: KIF3B Antibody [NBP2-82236] - Host: Rabbit. Target Name: Kif3b. Sample Type: Mouse Thymus lysates. Antibody Dilution: 1.0ug/ml
Western Blot: KIF3B Antibody [NBP2-82236] - Host: Rabbit. Target Name: KIF3B. Sample Tissue: Mouse Liver. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity Mu, Hu, Rt, Po, Bv, Ca, Eq, YeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KIF3B Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse KIF3B. Peptide sequence: GGGEEEEEEGEEGEEDGDDKDDYWREQQEKLEIEKRAIVEDHSLVAEEKM The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Human (100%), Rat (100%), Porcine (100%), Bovine (100%), Canine (100%), Equine (100%), Yeast (100%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
KIF3B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
82 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KIF3B Antibody

  • HH0048
  • KIAA0359Microtubule plus end-directed kinesin motor 3B
  • kinesin family member 3B
  • kinesin-like protein KIF3B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-76942
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP2-17055
Species: Hu
Applications: WB, IHC, IHC-P
NB500-180
Species: Hu, Mu, Rt, Po, Ma
Applications: WB, Simple Western, ICC/IF, IP, KO
NBP3-06363
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-81409
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP3-04508
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP
NBP2-49409
Species: Hu
Applications: IHC, IHC-P
NBP1-69123
Species: Mu, Rt
Applications: WB
BC110-60479
Species: Hu, Mu
Applications: ICC/IF, PEP-ELISA
NBP2-21667
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP1-81855
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KO
H00008502-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-30693
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83045
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3287
Species: Hu, Mu, Rt
Applications: WB
NBP2-01245
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-82236
Species: Mu, Hu, Rt, Po, Bv, Ca, Eq, Ye
Applications: WB

Publications for KIF3B Antibody (NBP2-82236) (0)

There are no publications for KIF3B Antibody (NBP2-82236).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KIF3B Antibody (NBP2-82236) (0)

There are no reviews for KIF3B Antibody (NBP2-82236). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KIF3B Antibody (NBP2-82236) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional KIF3B Products

Bioinformatics Tool for KIF3B Antibody (NBP2-82236)

Discover related pathways, diseases and genes to KIF3B Antibody (NBP2-82236). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KIF3B Antibody (NBP2-82236)

Discover more about diseases related to KIF3B Antibody (NBP2-82236).
 

Pathways for KIF3B Antibody (NBP2-82236)

View related products by pathway.

PTMs for KIF3B Antibody (NBP2-82236)

Learn more about PTMs related to KIF3B Antibody (NBP2-82236).

Blogs on KIF3B

There are no specific blogs for KIF3B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KIF3B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KIF3B