KIF21B Antibody - BSA Free

Immunohistochemistry-Paraffin: KIF21B Antibody [NBP1-84188] - Staining of human lymphoid tissues shows strong granular positivity in cytoplasm in non-germinal center cells.

Immunohistochemistry-Paraffin: KIF21B Antibody [NBP1-84188] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: KIF21B Antibody [NBP1-84188] - Staining of human testis shows moderate granular positivity in cytoplasm in cells in seminiferous ducts.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

KIF21B Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RKTQEVSALRRLAKPMSERVAGRAGLKPPMLDSGAEVSASTTSSEAESGARSVSSIVRQWNRKINHFLGDHPAPTVNGTRPARKKFQKKG
• Predicted Species: Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KIF21B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence Reported in scientific literature (PMID: 30479371)
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  KIF21B Protein (NBP1-84188PEP)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 30479371).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for KIF21B Antibody - BSA Free

• FLJ16314
• KIAA0449
• kinesin family member 21B

Background

KIF21B belongs to a family of plus end-directed kinesin (see MIM 600025) motor proteins. Neurons use kinesin and dynein (see MIM 600112) microtubule-dependent motor proteins to transport essential cellular components along axonal and dendritic microtubules.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for KIF21B Antibody (NBP1-84188)(1)

Publication using NBP1-84188

• Swarnkar S, Avchalumov Y, Raveendra BL et al. Kinesin Family of Proteins Kif11 and Kif21B Act as Inhibitory Constraints of Excitatory Synaptic Transmission Through Distinct Mechanisms. Sci Rep. 2018-11-27 [PMID: 30479371] (ICC/IF, Mouse)

Bioinformatics

• Gene Symbol: KIF21B