KIF20A Antibody - BSA Free

Western Blot: KIF20A Antibody [NBP1-87175] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunohistochemistry-Paraffin: KIF20A Antibody [NBP1-87175] - Staining of human testis shows strong nuclear positivity in cells of seminiferus ducts.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

KIF20A Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit KIF20A Antibody - BSA Free (NBP1-87175) is a polyclonal antibody validated for use in IHC and WB. Anti-KIF20A Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PLLSNEVIWLDSKQIRQEEMKKLSLLNGGLQEEELSTSLKRSVYIESRIGTSTSFDSGIAGLSSISQCTSSSQLDETSHRWAQPDTAPLPVPA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KIF20A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Theoretical MW: 100 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  KIF20A Protein (NBP1-87175PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (84%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for KIF20A Antibody - BSA Free

• FLJ21151
• GG10_2
• kinesin family member 20A
• kinesin-like protein KIF20A
• mitotic kinesin-like protein 2
• MKLP2
• Rab6-interacting kinesin-like protein
• RAB6KIFLkinesin-like (rabkinesin6)
• rabkinesin-6

Background

KIF20A is a member of the kinesin-like protein family and has 1 kinesin motor domain. It interacts with guanosine triphosphate (GTP)-bound forms of RAB6A and RAB6B and may act as a motor required for the retrograde RAB6 regulated transport of Golgi membranes and associated vesicles along microtubules. KIF20A has a microtubule plus end-directed motility.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for KIF20A Antibody (NBP1-87175)(1)

Publication using NBP1-87175

• Zhang L, Song W, Shi J, Chen Y Circ_0084188 Regulates the progression of colorectal cancer through the miR-769-5p/KIF20A axis Biochemical genetics 2023-02-10 [PMID: 36763221]

Bioinformatics

• Gene Symbol: KIF20A
• Entrez:
  • 10112(Human)
• Uniprot:
  • O95235(Human)