KIF15 Recombinant Protein Antigen

Images

 
There are currently no images for KIF15 Protein (NBP1-83252PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

KIF15 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KIF15.

Source: E.coli

Amino Acid Sequence: ESLLATEKVISSLEKSRDSDKKVVADLMNQIQELRTSVCEKTETIDTLKQELKDINCKYNSALVDREESRVLIKKQEVDILD

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KIF15
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-83252.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for KIF15 Recombinant Protein Antigen

  • FLJ25667
  • HKLP2
  • kinesin family member 15
  • kinesin-like 7
  • Kinesin-like protein 2
  • Kinesin-like protein 7
  • kinesin-like protein KIF15
  • KLP2
  • KNSL7
  • NY-BR-62
  • Serologically defined breast cancer antigen NY-BR-62

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-179
Species: Hu, Mu, Rt, Po, Ma
Applications: WB, Simple Western, Flow, ICC/IF, IP
NB500-181
Species: Hu, Mu, Rt, Po, Dr
Applications: WB, ICC/IF, IP
NBP2-17299
Species: Hu
Applications: WB, ICC/IF
NBP1-88856
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-43633
Species: Hu
Applications: WB, ICC/IF
NBP2-17052
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-51843
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-61832
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB500-182
Species: Hu, Mu, Rt, Ma
Applications: WB, ICC/IF, IP
NB100-547
Species: Hu
Applications: WB, ICC/IF, IP
NBP2-36749
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-51843
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00009278-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-37471
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB100-40844
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-1059
Species: Hu, Ca
Applications: WB, IHC, IHC-P, PEP-ELISA
NB500-174
Species: Hu, Mu, Rt, Ma, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-38794
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83723
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83252PEP
Species: Hu
Applications: AC

Publications for KIF15 Protein (NBP1-83252PEP) (0)

There are no publications for KIF15 Protein (NBP1-83252PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KIF15 Protein (NBP1-83252PEP) (0)

There are no reviews for KIF15 Protein (NBP1-83252PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for KIF15 Protein (NBP1-83252PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for KIF15 Protein (NBP1-83252PEP)

Discover related pathways, diseases and genes to KIF15 Protein (NBP1-83252PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KIF15 Protein (NBP1-83252PEP)

Discover more about diseases related to KIF15 Protein (NBP1-83252PEP).
 

Pathways for KIF15 Protein (NBP1-83252PEP)

View related products by pathway.

PTMs for KIF15 Protein (NBP1-83252PEP)

Learn more about PTMs related to KIF15 Protein (NBP1-83252PEP).

Blogs on KIF15.

Ki67 - an established marker for labelling proliferating cells
Ki-67/MKI67 is an antigen which is expressed during G1, S, G2, and M phases of the cell cycle (mitotically active cells), but not during G0 phase (resting cells). It is a large protein with expected molecular weight of about 395 kDa, and it has a v...  Read full blog post.

Ki67 - A Crucial Cellular Proliferation Marker
The Ki67 antigen is a prototypic cell cycle-related protein expressed by proliferating cells in all phases of the active cell cycle (G1, S, G2 and M). It is a non-histone nuclear protein originally identified in a Hodgkin's lymphoma-derived cell line....  Read full blog post.

Customers Who Bought This Also Bought

TPX2 Antibody
NB500-179
KIF15 Antibody
NBP2-34009
NuMA Antibody
NB500-174

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our KIF15 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol KIF15