KIAA0319 Antibody

Images

 
Immunohistochemistry: KIAA0319 Antibody [NBP1-86455] - Staining of human hippocampus shows distinct positivity in nerve fibers and neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KIAA0319 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GRTYSNAVISPNLETTRIMRVSHTFPVVDCTAACCDLSSCDLAWWFEGRCYLVSCPHKENCEPKKMGPIRSYLTFVLRPVQRPAQLLDYGDMMLNRGSPSGIWGDSPEDIRKDLPFLGKDWGLEEMSEYSDDYRELEKDLLQPSG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KIAA0319
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
KIAA0319 Protein (NBP1-86455PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KIAA0319 Antibody

  • 4930451E12Rik
  • D130043K22
  • DLX2
  • DYLX2
  • dyslexia susceptibility 2
  • DYX2
  • KIAA0319
  • MGC176717
  • NMIG

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-47476
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-2806
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-57578
Species: Hu
Applications: WB
NBP1-88036
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-87349
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF1749
Species: Rt
Applications: WB, IHC
NBP2-29990
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-05984
Species: Hu, Mu
Applications: WB, IP
H00079932-B01P
Species: Hu
Applications: WB, ELISA
NBP2-33795
Species: Hu
Applications: WB, IHC, IHC-P
NB100-55411
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP1-92498
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31844
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00001646-M03
Species: Hu
Applications: WB, ELISA
NBP1-30914
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87076
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76567
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
AF1440
Species: Mu
Applications: WB
NBP1-88182
Species: Hu
Applications: WB, IHC, IHC-P

Publications for KIAA0319 Antibody (NBP1-86455) (0)

There are no publications for KIAA0319 Antibody (NBP1-86455).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KIAA0319 Antibody (NBP1-86455) (0)

There are no reviews for KIAA0319 Antibody (NBP1-86455). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for KIAA0319 Antibody (NBP1-86455) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KIAA0319 Products

Bioinformatics Tool for KIAA0319 Antibody (NBP1-86455)

Discover related pathways, diseases and genes to KIAA0319 Antibody (NBP1-86455). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KIAA0319 Antibody (NBP1-86455)

Discover more about diseases related to KIAA0319 Antibody (NBP1-86455).
 

Pathways for KIAA0319 Antibody (NBP1-86455)

View related products by pathway.

PTMs for KIAA0319 Antibody (NBP1-86455)

Learn more about PTMs related to KIAA0319 Antibody (NBP1-86455).

Blogs on KIAA0319

There are no specific blogs for KIAA0319, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KIAA0319 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KIAA0319
Entrez