Home » KHDC1 » KHDC1 Antibodies » KHDC1 Antibody

KHDC1 Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: KHDC1 Antibody [NBP1-88798] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol & mitochondria.
Immunocytochemistry/ Immunofluorescence: KHDC1 Antibody [NBP1-88798] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol & mitochondria.
Immunohistochemistry-Paraffin: KHDC1 Antibody [NBP1-88798] - Staining of human cerebral cortex shows weak cytoplasmic positivity in neuropil.
Immunohistochemistry: KHDC1 Antibody [NBP1-88798] - Staining of human liver shows distinct cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

KHDC1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RERNSRSGKTRCRSKRSEQSMDMGTSALSKKPWWTLPQNFHAPMVFHMEEDQEELIFGHGD
Specificity
Specificity of human KHDC1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KHDC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
KHDC1 Protein (NBP1-88798PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KHDC1 Antibody

  • bA257K9.4
  • C6orf148
  • chromosome 6 open reading frame 148
  • KH homology domain containing 1
  • KH homology domain-containing protein 1
  • MGC10818
  • NDG1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NGFI-B
alpha/Nur77/NR4A1 Ant
NB100-56745
Western Blot: NGFI-B alpha/Nur77/NR4A1 Antibody [NB100-56745] - Analysis of Nur77 (Nak-1) in 15 ugs of NIH3T3 cell lysate using Nur77 antibody at 1:500 dilution
Immunocytochemistry/Immunofluorescence: NGFI-B alpha/Nur77/NR4A1 Antibody [NB100-56745] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-NGFI-B alpha at 5 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunocytochemistry/Immunofluorescence: NGFI-B alpha/Nur77/NR4A1 Antibody [NB100-56745] - NUR77 antibody was tested in Jurkat cells at a 1:50 dilution against Dylight 488 (Green). Alpha tubulin and nuclei were counterstained against Dylight 568 (Red) and DAPI (Blue), respectively.
(11 Publications)
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IP
ECAT1 Antibody
NBP1-91737
Western Blot: ECAT1 Antibody [NBP1-91737] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: ECAT1 Antibody [NBP1-91737] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.
(2 Publications)
Species: Hu
Applications: WB, IHC, IHC-P, IHC-WhMt
Oocyte Expressed
Protein Antibody
NBP2-30762
Immunohistochemistry: Oocyte Expressed Protein Antibody [NBP2-30762] - Staining of human ovary shows moderate cytoplasmic positivity in oocyte.
Species: Hu
Applications: IHC, IHC-P
DPPA5/ESG1 Antibody
AF3125
DPPA5/ESG1 Antibody
Species: Hu
Applications: WB, ICC
NANOGP8 Antibody
H00388112-B01P
Western Blot: NANOGP8 Antibody [H00388112-B01P] - Analysis of NANOGP8 expression in transfected 293T cell line by NANOGP8 polyclonal antibody. Lane 1: NANOGP8 transfected lysate(33.55 KDa). Lane 2: Non-transfected lysate.
Species: Hu
Applications: WB, ELISA
Nanog Antibody
[Unconjugated]
AF1997
Western blot shows lysates of BG01V human embryonic stem cells and Tera‑2 human embryonic lung carcinoma cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human Nanog Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1997) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Nanog at approximately 40 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 9.
Nanog was detected in immersion fixed ADLF1 (top panel) and FAB2 (bottom panel) induced pluripotent stem cell lines using Goat Anti-Human Nanog Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1997) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Stem Cells on Coverslips.
Nanog was detected in immersion fixed BG01V human embryonic stem cells using 10 µg/mL Goat Anti-Human Nanog Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1997) for 3 hours at room temperature. Cells were stained with the Northern­Lights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(9 Reviews)
(80 Publications)
Species: Hu
Applications: WB, ChIP, ICC
GLYAT Antibody
NBP2-55298
Western Blot: GLYAT Antibody [NBP2-55298] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunohistochemistry-Paraffin: GLYAT Antibody [NBP2-55298] - Staining in human kidney and skeletal muscle tissues using anti-GLYAT antibody. Corresponding GLYAT RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: GLYAT Antibody [NBP2-55298] - Staining of human kidney shows high expression.
Species: Hu
Applications: WB, IHC, IHC-P
GPR50 Antibody
(461129)
MAB4645
GPR50 was detected in immersion fixed A172 human glioblastoma cell line using 10 µg/mL Mouse Anti-Human GPR50 Monoclonal Antibody (Catalog # MAB4645) for 3 hours at room temperature. Cells were stained with the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red, upper panel; Catalog # NL007) and counterstained with DAPI (blue, lower panel). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
A172 human glioblastoma cell line was stained with Mouse Anti-Human GPR50 Monoclonal Antibody (Catalog # MAB4645, filled histogram) or isotype control antibody (Catalog # MAB0031, open histogram), followed by Phycoerythrin-conjugated Anti-Mouse IgG F(ab')2 Secondary Antibody (Catalog # F0102B). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
Species: Hu
Applications: CyTOF-ready, ICC, ICFlow
Oocyte Expressed
Protein Antibody
NBP2-30762
Immunohistochemistry: Oocyte Expressed Protein Antibody [NBP2-30762] - Staining of human ovary shows moderate cytoplasmic positivity in oocyte.
Species: Hu
Applications: IHC, IHC-P
CRAT Antibody
NBP1-86614
Western Blot: CRAT Antibody [NBP1-86614] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human liver tissue
Immunohistochemistry-Paraffin: CRAT Antibody [NBP1-86614] - Staining of human tonsil shows low expression as expected.
Immunohistochemistry-Paraffin: CRAT Antibody [NBP1-86614] - Analysis in human testis and tonsil tissues using Anti-CRAT antibody. Corresponding CRAT RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Catalase Antibody
NBP2-24916
Western Blot: Catalase Antibody [NBP2-24916] - Analysis in liver lysate of 1) human 2) mouse and 3) rat at 0.1 ug/ml.
Immunohistochemistry-Paraffin: Catalase Antibody [NBP2-24916] - Staining of human liver tissue using an isotype control (top) and this antibody (bottom) at 5 ug/ml.
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
TRAIL/TNFSF10
[Unconjugated]
375-TL/CF
TRAIL/TNFSF10 [Unconjugated]
(30 Publications)
Species: Hu
OVGP1 Antibody
NBP1-76939
Western Blot: OVGP1 Antibody [NBP1-76939] - Human placenta tissue lysate with OVGP1 antibody at 1 ug/mL.
Immunocytochemistry/Immunofluorescence: OVGP1 Antibody [NBP1-76939] - Staining of OVGP in 293 cells with OVGP antibody at 5 ug/ml.
Immunocytochemistry/Immunofluorescence: OVGP1 Antibody [NBP1-76939] - 293 cells with OVGP1 antibody at 2.5 ug/ml.
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Transglutaminase
4/TGM4 Antibody
AF5760
Western blot shows lysates of PC‑3 human prostate cancer cell line. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human Transglutaminase 4/TGM4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5760) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Transglutaminase 4/TGM4 at approximately 77 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Transglutaminase 4/TGM4 was detected in paraffin-embedded sections of human prostate using Sheep Anti-Human Transglutaminase 4/TGM4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5760) at 10 µg/mL overnight at 4 °C. Before incubation with the primary antibody tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Transglutaminase 4/TGM4 was detected in immersion fixed paraffin-embedded sections of human prostate using Sheep Anti-Human Transglutaminase 4/TGM4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5760) at 10 µg/mL overnight at 4 °C. Before incubation with the primary antibody tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Species: Hu
Applications: WB, IHC
Cytochrome c
Antibody (7H8.2C12)
NB100-56503
Western Blot: Cytochrome c Antibody (7H8.2C12) [NB100-56503] - Analysis using the Biotin conjugate of NB100-56503. Detection of Cytochrome C in 15 mgs of HeLa cell lysate using NB100-55775 at 1:1000. A 15 kDa band is detected.
Immunocytochemistry/Immunofluorescence: Cytochrome c Antibody (7H8.2C12) [NB100-56503] - p73 was detected in immersion fixed Hela human cell line using Cytochrome C [7H8.2C12] Monoclonal Antibody (Catalog # NB100-56503) at 25 ug/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Staining was observed in the cytoplasm and mitochondria.
Immunohistochemistry-Paraffin: Cytochrome c Antibody (7H8.2C12) [NB100-56503] - Cytochrome C was detected in immersion fixed paraffin-embedded sections of human heart using anti-human mouse monoclonal antibody (Catalog # NB100-56503) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue).Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
(47 Publications)
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, Flow-IC
Bcl-2 Antibody
NB100-56098
Western Blot: Bcl-2 Antibody [NB100-56098] - Analysis of Bcl-2 in whole cell lysate from Daoy cells. Cells were transfected with scrambled control siRNA (lane 1) or Bcl-2 siRNA (lane2). Image from verified customer review.
Western Blot: Bcl-2 Antibody [NB100-56098] - WB analysis of whole cell lysate (WCL) of Jurkat cells using anti-Bcl-2 antibody (NB100-56098) at 1:1000 dilution. HRP conjugated goat anti-rabbit IgG (H+L) cross adsorbed secondary antibody was used with ECL substrate for the detection of Bcl2 antibody bound to the blotted protein. This Bcl2 antibody detected a specific band at expected molecular weight marker position of Bcl2 protein (26kDa).
Immunohistochemistry-Paraffin: Bcl-2 Antibody [NB100-56098] - IHC analysis of a formalin-fixed paraffin-embedded (FFPE) human breast carcinoma tissue section using 1:1000 dilution of Bcl-2 antibody (NB100-56098) on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) with 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching using peroxide block. The sections were incubated with primary antibody for 30 minutes. Bond Polymer Refine Detection (Leica Biosystems) and DAB were used for signal detection which followed counterstaining with hematoxylin. Whole slide scanning and capturing of representative images (20X) were performed using Aperio AT2 (Leica Biosystems). This antibody generated a diffused cytoplasmic staining of BCL2 in the cancer cells with relatively intense signal in their nuclear membranes. Staining was performed by Histowiz.
(2 Reviews)
(6 Publications)
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
IBSP/Sialoprotein
II
4014-SP
IBSP/Sialoprotein II
(2 Publications)
Species: Hu
KHDC1 Antibody
NBP1-88798
KHDC1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for KHDC1 Antibody (NBP1-88798) (0)

There are no publications for KHDC1 Antibody (NBP1-88798).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KHDC1 Antibody (NBP1-88798) (0)

There are no reviews for KHDC1 Antibody (NBP1-88798). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for KHDC1 Antibody (NBP1-88798) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KHDC1 Products

Bioinformatics Tool for KHDC1 Antibody (NBP1-88798)

Discover related pathways, diseases and genes to KHDC1 Antibody (NBP1-88798). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for KHDC1 Antibody (NBP1-88798)

View related products by pathway.

Blogs on KHDC1

There are no specific blogs for KHDC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KHDC1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol KHDC1