Kell Recombinant Protein Antigen

Images

 
There are currently no images for Kell Recombinant Protein Antigen (NBP3-17727PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Kell Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Kell

Source: E. coli

Amino Acid Sequence: PRPCETSVCLDLRDHYLASGNTSVAPCTDFFSFACGRAKETNNSFQELATKNKNRLRRILEVQNSWHPGSGEEKAFQFYNSCMDTLAIEAAGTGPLRQVIEELGGWRISGKWT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KEL
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17727.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Kell Recombinant Protein Antigen

  • CD238 antigen
  • CD238
  • EC 3.4.24.-
  • ECE3
  • KEL
  • kell blood group antigen
  • kell blood group glycoprotein
  • Kell blood group
  • Kell blood group, metalloendopeptidase
  • Kell blood group, metallo-endopeptidase
  • Kell

Background

KELL, also known as Kell blood group glycoprotein, is a 732 amino acid protein that is 83 kDa; expressed at high levels in erythrocytes and testis (in Sertoli cells), and, at lower levels, in skeletal muscle, tonsils (in follicular dendritic cells), lymph node, spleen and appendix; links via a single disulfide bond to the XK membrane protein that carries the Kx antigen; it is a zinc endopeptidase with endothelin-3-converting enzyme activity that cleaves EDN1, EDN2 and EDN3, with a marked preference for EDN3. Disease research is currently being studied with relation to KELL and tinea corporis, fetal erythroblastosis, carbuncle, erysipelas, scabies, alloimmunization, tinea, chronic granulomatous disease, tonsillitis, pneumonia, tuberculosis, protein s deficiency, acute chest syndrome, and autoimmune hemolytic anemia. This protein involvement has been observed with relation to XK, EDN1, EDN2, EDN3, and EWSR1 in proteolysis and vasoconstriction pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-17923
Species: Hu
Applications: IHC,  IHC-P
NBP2-84247
Species: Hu
Applications: WB
NB500-525
Species: Hu
Applications: ELISA, IHC,  IHC-P, WB
NB100-2421
Species: Hu
Applications: Flow, IHC,  IHC-P, PEP-ELISA, WB
NBP2-31781
Species: Hu
Applications: IHC,  IHC-P
NBP2-24750
Species: Hu, Mu, Pm, Rt
Applications: IHC,  IHC-P, WB
NBP2-02939
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, WB
MAB1228
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP
NBP2-93011
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
H00002316-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, PLA, WB
NBL1-11414
Species: Hu
Applications: WB
NB100-55735
Species: Bv, Ca, Ch, Hu, Mu, Pm
Applications: ICC/IF, IP, WB
DHAPG0
Species: Hu
Applications: ELISA
NBP2-16374
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-35061
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IP, WB
DY523B-05
Species: Hu
Applications: ELISA
NBP2-46477
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-17727PEP
Species: Hu
Applications: AC

Publications for Kell Recombinant Protein Antigen (NBP3-17727PEP) (0)

There are no publications for Kell Recombinant Protein Antigen (NBP3-17727PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kell Recombinant Protein Antigen (NBP3-17727PEP) (0)

There are no reviews for Kell Recombinant Protein Antigen (NBP3-17727PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Kell Recombinant Protein Antigen (NBP3-17727PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Kell Products

Research Areas for Kell Recombinant Protein Antigen (NBP3-17727PEP)

Find related products by research area.

Blogs on Kell

There are no specific blogs for Kell, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Kell Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol KEL