Kelch-Like 3 Antibody - Azide and BSA Free

Western Blot: Kelch-Like 3 Antibody [NBP3-03236] - Analysis of extracts of various cell lines, using Kelch-Like 3 antibody at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.

• Reactivity: Hu, Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Kelch-Like 3 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit Kelch-Like 3 Antibody - Azide and BSA Free (NBP3-03236) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human Kelch-Like 3 (NP_059111.2). MEGESVKLSSQTLIQAGDDEKNQRTITVNPAHMGKAFKVMNELRSKQLLCDVMIVAEDVEIEAHRVVLAACSPYFCAMFTGDMSESKAKKIEIKDVDGQTLSKLIDYIYT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KLHL3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for Kelch-Like 3 Antibody - Azide and BSA Free

• FLJ40871
• kelch-like 3 (Drosophila)
• kelch-like protein 3
• KIAA1129kelch (Drosophila)-like 3
• MGC44594

Background

KLHL3, also known as Kelch-like protein 3; has 3 isoforms, a 65 kDa 587 amino acid isoform A, a 61 kDa 555 amino acid isoform B, and a 56 kDa 505 amino acid isoform C; acts as a substrate-specific adapter of a BCR (BTB-CUL3-RBX1) E3 ubiquitin ligase complex that plays a role of regulator in ion transport of the distal nephron. The BCR(KLHL3) complex may regulate the SLC12A3/NCC subcellular location at the cell membrane by mediating ubiquitination of SLC12A3/NCC. There has been research revolving around the KLHL3 protein involvement in pharyngitis and pseudohypoaldosteronism. The protein has been shown to interact with OPRD1, GNAO1, SYT2, SYNCRIP, and GNAI1 proteins in protein ubiquitination, renal sodium ion absorption, and distal tubule morphogenesis pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: KLHL3