KDM6A Recombinant Protein Antigen

Images

 
There are currently no images for KDM6A Protein (NBP1-80628PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

KDM6A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KDM6A.

Source: E. coli

Amino Acid Sequence: IGNNHITGSGSNGNVPYLQRNALTLPHNRTNLTSSAEEPWKNQLSNSTQGLHKGQSSHSAGPNGERPLSSTGPSQHLQAAGSGIQNQNGHPTLPSNSVTQGAALNHLSSHTATSGGQQGITLTKESKPSGNILTVPETSRHT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KDM6A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-80628.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for KDM6A Recombinant Protein Antigen

  • bA386N14.2 (ubiquitously transcribed X chromosome tetratricopeptide repeatprotein (UTX))
  • bA386N14.2
  • DKFZp686A03225
  • EC 1.14.11
  • EC 1.14.11.-
  • Histone demethylase UTX
  • KABUK2
  • KDM6A
  • Lysine (K)specific Demethylase 6A
  • Lysine (K)-specific Demethylase 6A
  • MGC141941
  • ubiquitously transcribed tetratricopeptide repeat protein X-linked
  • ubiquitously transcribed tetratricopeptide repeat, X chromosome
  • ubiquitously transcribed TPR protein on the X chromosome
  • ubiquitously transcribed X chromosome tetratricopeptide repeat protein
  • ubiquitously-transcribed TPR gene on the X chromosome
  • Ubiquitously-transcribed TPR protein on the X chromosome
  • Ubiquitously-transcribed X chromosome tetratricopeptide repeat protein
  • UTX
  • UTXlysine-specific demethylase 6A

Background

UTX - ubiquitously transcribed tetratricopeptide repeat, X chromosome

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-06640
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, WB
NB500-171
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC,  IHC-P, Single-Cell Western, WB
NB100-81657
Species: Hu, Mu
Applications: ChIP, IHC,  IHC-P, IP, WB
AF4767
Species: Hu, Mu
Applications: ICC, WB
NB100-55328
Species: Hu
Applications: IP, WB
H00171023-M05
Species: Hu
Applications: ELISA, IP, WB
NBP3-11015
Species: Hu
Applications: WB
NBP3-03807
Species: Hu, Mu, Rt
Applications: ICC/IF, IP, WB
NBP2-32104
Species: Hu
Applications: IHC,  IHC-P, IP, WB
AF5738
Species: Hu
Applications: ICC, KO, Simple Western, WB
MAB4260
Species: Hu, Mu, Rt
Applications: Simple Western, WB
NB120-13888
Species: Hu, Mu, Rt
Applications: ChIP, ChIP, CyTOF-ready, Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr,  IHC-P, KD, KO, WB
NBP2-45411
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-52457
Species: Ha, Hu, Pm, Mu, Rt
Applications: CyTOF-ready, ELISA, Flow, ICC, ICC/IF, IHC,  IHC-P, WB
MAB7049
Species: Hu
Applications: ICC, IHC, KO, Simple Western, WB
NBP1-80628PEP
Species: Hu
Applications: AC

Publications for KDM6A Protein (NBP1-80628PEP) (0)

There are no publications for KDM6A Protein (NBP1-80628PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KDM6A Protein (NBP1-80628PEP) (0)

There are no reviews for KDM6A Protein (NBP1-80628PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for KDM6A Protein (NBP1-80628PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional KDM6A Products

Blogs on KDM6A.

Breast cancer stem cells survive chemotherapy through S100A10-ANXA2-SPT6 interaction that epigenetically promotes OCT4-mediated stemness
By Jamshed Arslan, Pharm D, PhDBreast cancer is the most common cancer among women that causes the greatest number of cancer-related deaths worldwide. After radiotherapy or cytotoxic chemotherapy like paclitax...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our KDM6A Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol KDM6A