KDM2B Antibody

Images

 
Western Blot: KDM2B Antibody [NBP1-80379] - Human Stomach, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KDM2B Antibody Summary

Immunogen
Synthetic peptide directed towards the middle region of human FBXL10 (NP_115979). Peptide sequence LSFFKRCGNICHIDLRYCKQVTKEGCEQFIAEMSVSVQFGQVEEKLLQKL.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KDM2B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Theoretical MW
153 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for KDM2B Antibody

  • [Histone-H3]-lysine-36 demethylase 1B
  • CXXC2F-box protein FBL10
  • CXXC-type zinc finger protein 2
  • Fbl10
  • F-box and leucine-rich repeat protein 10JEMMA (Jumonji domain, EMSY-interactor, methyltransferase motif) protein
  • FBXL10
  • JHDM1BF-box/LRR-repeat protein 10
  • JmjC domain-containing histone demethylation protein 1B
  • jumonji C domain-containing histone demethylase 1B
  • Jumonji domain-containing EMSY-interactor methyltransferase motif protein
  • lysine (K)-specific demethylase 2B
  • lysine-specific demethylase 2B
  • PCCX2EC 1.14.11.27
  • protein containing CXXC domain 2
  • Protein JEMMA
  • Protein-containing CXXC domain 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-74602
Species: Hu
Applications: WB, IHC, IHC-P, IP, ChIP
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
MAB6798
Species: Hu
Applications: WB, ICC
NBP1-30141
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00006045-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-82767
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56537
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IP
H00029107-M08
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-82454
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-81657
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, ChIP
NB100-56346
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
H00008337-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-67881
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88856
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-82805
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46571
Species: Hu
Applications: WB
NB100-1762
Species: Hu, Mu, Pm
Applications: WB, Simple Western, ChIP, ELISA, IHC, IHC-P

Publications for KDM2B Antibody (NBP1-80379) (0)

There are no publications for KDM2B Antibody (NBP1-80379).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KDM2B Antibody (NBP1-80379) (0)

There are no reviews for KDM2B Antibody (NBP1-80379). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KDM2B Antibody (NBP1-80379) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional KDM2B Products

Array NBP1-80379

Bioinformatics Tool for KDM2B Antibody (NBP1-80379)

Discover related pathways, diseases and genes to KDM2B Antibody (NBP1-80379). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KDM2B Antibody (NBP1-80379)

Discover more about diseases related to KDM2B Antibody (NBP1-80379).
 

Pathways for KDM2B Antibody (NBP1-80379)

View related products by pathway.

PTMs for KDM2B Antibody (NBP1-80379)

Learn more about PTMs related to KDM2B Antibody (NBP1-80379).

Blogs on KDM2B

There are no specific blogs for KDM2B, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KDM2B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KDM2B
Entrez
Uniprot
COVID-19 update