KDEL Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: KDEL Antibody [NBP2-55448] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KDEL Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LSPEKSEIWGPGLKADVVLPARYFYIQAVDTSGNKFTSSPGEKVFQVKVSAPEEQFTRVGVQVLDRKDGSF
Specificity
Specificity of human KDEL antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
POGLUT2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
KDEL Recombinant Protein Antigen (NBP2-55448PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for KDEL Antibody

  • Endoplasmic reticulum resident protein 58
  • EP58KDEL1
  • ER protein 58
  • ERp58
  • KDEL (Lys-Asp-Glu-Leu) containing 1
  • KDEL motif-containing 1
  • KDEL motif-containing protein 1
  • MGC5302

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31214
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4919
Species: Mu
Applications: WB, IHC
H00001032-M08
Species: Hu
Applications: WB, ELISA, IP, S-ELISA
NB100-2425
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85367
Species: Hu, Mu, Rt, V-Vi
Applications: WB, IHC, IHC-P
NBP1-90311
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-13215
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-92047
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84899
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB1259
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
AF1190
Species: Rt
Applications: WB, Flow, IHC, Block, CyTOF-ready
NBP2-55448
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for KDEL Antibody (NBP2-55448) (0)

There are no publications for KDEL Antibody (NBP2-55448).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KDEL Antibody (NBP2-55448) (0)

There are no reviews for KDEL Antibody (NBP2-55448). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for KDEL Antibody (NBP2-55448) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional KDEL Products

Array NBP2-55448

Bioinformatics Tool for KDEL Antibody (NBP2-55448)

Discover related pathways, diseases and genes to KDEL Antibody (NBP2-55448). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KDEL Antibody (NBP2-55448)

Discover more about diseases related to KDEL Antibody (NBP2-55448).
 

Pathways for KDEL Antibody (NBP2-55448)

View related products by pathway.

Research Areas for KDEL Antibody (NBP2-55448)

Find related products by research area.

Blogs on KDEL

There are no specific blogs for KDEL, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KDEL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol POGLUT2