KCNT2 Antibody

Images

 
Western Blot: KCNT2 Antibody [NBP2-85139] - Host: Rabbit. Target Name: KCNT2. Sample Tissue: Human U937 Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KCNT2 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human KCNT2. Peptide sequence: RREDNKNILLNPGPRYIMNSTDICFYINITKEENSAFKNQDQQRKSNVSR The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
KCNT2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KCNT2 Antibody

  • KCa4.2
  • MGC119610
  • MGC119611
  • MGC119612
  • potassium channel subfamily T member 2
  • potassium channel, subfamily T, member 2
  • Sequence like an intermediate conductance potassium channel subunit
  • SLICKMGC119613
  • SLO2.1
  • sodium activated potassium channel
  • sodium and chloride activated ATP sensitive potassium channel
  • Sodium and chloride-activated ATP-sensitive potassium channel Slo2.1
  • sodium- and chloride-activated ATP-sensitive potassium channel
  • sodium-and chloride-activated ATP-sensitive potassium channel (SLICK)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-80516
Species: Mu, Rt
Applications: IHC, IHC-P, WB
NB100-2737
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-87822
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-48615
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-28872
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB110-39033
Species: Ch, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-20119
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-87781
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-12897
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
NBP3-03109
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-86856
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-83132
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-84556
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-87466
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
DBD00
Species: Hu
Applications: ELISA
NB100-56565
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP2-84246
Species: Hu
Applications: WB
NBP2-85139
Species: Hu
Applications: WB

Publications for KCNT2 Antibody (NBP2-85139) (0)

There are no publications for KCNT2 Antibody (NBP2-85139).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KCNT2 Antibody (NBP2-85139) (0)

There are no reviews for KCNT2 Antibody (NBP2-85139). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KCNT2 Antibody (NBP2-85139) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KCNT2 Products

Bioinformatics Tool for KCNT2 Antibody (NBP2-85139)

Discover related pathways, diseases and genes to KCNT2 Antibody (NBP2-85139). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KCNT2 Antibody (NBP2-85139)

Discover more about diseases related to KCNT2 Antibody (NBP2-85139).
 

Pathways for KCNT2 Antibody (NBP2-85139)

View related products by pathway.

Research Areas for KCNT2 Antibody (NBP2-85139)

Find related products by research area.

Blogs on KCNT2

There are no specific blogs for KCNT2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KCNT2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNT2