KCNT2 Antibody - BSA Free

Western Blot: KCNT2 Antibody [NBP2-85139] - Host: Rabbit. Target Name: KCNT2. Sample Tissue: Human U937 Whole Cell lysates. Antibody Dilution: 1ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

KCNT2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit KCNT2 Antibody - BSA Free (NBP2-85139) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KCNT2. Peptide sequence: RREDNKNILLNPGPRYIMNSTDICFYINITKEENSAFKNQDQQRKSNVSR The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KCNT2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for KCNT2 Antibody - BSA Free

• KCa4.2
• MGC119610
• MGC119611
• MGC119612
• potassium channel subfamily T member 2
• potassium channel, subfamily T, member 2
• Sequence like an intermediate conductance potassium channel subunit
• SLICKMGC119613
• SLO2.1
• sodium activated potassium channel
• sodium and chloride activated ATP sensitive potassium channel
• Sodium and chloride-activated ATP-sensitive potassium channel Slo2.1
• sodium- and chloride-activated ATP-sensitive potassium channel
• sodium-and chloride-activated ATP-sensitive potassium channel (SLICK)

Background

FUCNTION: Outward rectifying potassium channel. Produces rapidly activating outward rectifier K(+) currents. Activated by high intracellular sodium and chloride levels. Channel activity is inhibited by ATP and by inhalation anesthetics, such as isoflurane. Inhibited upon stimulation of G-protein coupled receptors, such as CHRM1 and GRIA1.; Subcellular location: Cell membrane; Multi-pass membrane protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KCNT2