KCNK10 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of human KCNK10. Peptide sequence: VVAIFVVVVVYLVTGGLVFRALEQPFESSQKNTIALEKAEFLRDHVCVSP The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
KCNK10 |
| Purity |
Protein A purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
1 mg/ml |
| Purity |
Protein A purified |
Alternate Names for KCNK10 Antibody - BSA Free
Background
KCNK10, also known as Potassium channel subfamily K member 10, has 3 isoforms, Isoform A that is 538 amino acid and app. 60 kDa, Isoform B that is 543 amino acid and app. 60 kDa, and Isoform C That is 543 amino acid and app. 60 kDa; expressed in pancreas and kidney and to a lower level in brain, testis, colon, and small intestine; belongs to the family of potassium channel proteins containing two pore-forming P domains; outwards rectifying potassium channel, produces rapidly activating and non-inactivating outward rectifier K(+) currents, activated by arachidonic acid and other naturally occurring unsaturated free fatty acids. Studies are being performed on the relationship of this protein with dentin sensitivity, brain ischemia, and ischemia. The protein has been shown to interact with AKAP150 protein and has been involved in several pathways including cholera infection, neuropathic pain-signaling in dorsal horn neurons, hepatic ABC transporters, PKA signaling, potassium transporters - outward current, gastric, and sweet taste signaling.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Hu, Mu
Applications: ICC/IF (-), IHC (-), WB
Species: Hu
Applications: ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Block, CyTOF-reported, Flow
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, In, Mu, Pm, Rt
Applications: ICC/IF, IF, IHC (-), WB
Publications for KCNK10 Antibody (NBP2-87665) (0)
There are no publications for KCNK10 Antibody (NBP2-87665).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for KCNK10 Antibody (NBP2-87665) (0)
There are no reviews for KCNK10 Antibody (NBP2-87665).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for KCNK10 Antibody (NBP2-87665) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional KCNK10 Products
Research Areas for KCNK10 Antibody (NBP2-87665)
Find related products by research area.
|
Blogs on KCNK10