KCNJ14 Antibody - BSA Free

Western Blot: KCNJ14 Antibody [NBP2-83104] - Host: Rabbit. Target Name: KCNJ14. Sample Tissue: Rat Small Intestine lysates. Antibody Dilution: 1ug/ml

Product Discontinued

KCNJ14 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit KCNJ14 Antibody - BSA Free (NBP2-83104) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of rat KCNJ14. Peptide sequence: YIPLDHQDVDVGFDGGTDRIFLVSPITIVHEIDSASPLYELGRAELARADF The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KCNJ14
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for KCNJ14 Antibody - BSA Free

• ATP-sensitive inward rectifier potassium channel 14
• IRK4
• KIR2.4
• potassium inwardly-rectifying channel, subfamily J, member 14

Background

Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel, and probably has a role in controlling the excitability of motor neurons. Two transcript variants encoding the same protein have been found for this gene. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KCNJ14