KCNJ1 Antibody - BSA Free

Western Blot: KCNJ1 Antibody [NBP2-87660] - Lanes: Lane 1: 30ug mouse renal epithelial lysate. Lane 2: 30ug mouse renal epithelial lysate. Lane 3: 30ug mouse renal epithelial lysate. Primary Antibody Dilution: 1:500. Secondary Antibody: Anti-rabbit-HRP. Secondary Antibody Dilution: 1:2500. Gene Name: KCNJ1. Submitted by: Dr. JUNMING FAN,ECU.

Western Blot: KCNJ1 Antibody [NBP2-87660] - WB Suggested Anti-KCNJ1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: HepG2 cell lysate

• Reactivity: Hu, Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

KCNJ1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit KCNJ1 Antibody - BSA Free (NBP2-87660) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KCNJ1. Peptide sequence: LRKSLLIGSHIYGKLLKTTVTPEGETIILDQININFVVDAGNENLFFISP The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KCNJ1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for KCNJ1 Antibody - BSA Free

• ATP-regulated potassium channel ROM-K
• ATP-sensitive inward rectifier potassium channel 1
• inwardly rectifying K+ channel
• KIR1.1
• potassium inwardly-rectifying channel, subfamily J, member 1
• ROMK1inwardly rectifying subfamily J member 1

Background

FUNCTION: In the kidney, probably plays a major role in potassium homeostasis. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. This channel is activated by internal ATP and can be blocked by external barium.; Tissue specificity: In the kidney and pancreatic islets. Lower levels in skeletal muscle, pancreas, spleen, brain, heart and liver.; Subcellular location: Membrane, Multi-pass membrane protein.; Involvement in disease: Defects in KCNJ1 are the cause of Bartter syndrome type 2 (BS2) also termed hyperprostanglandin E syndrome 2. BS refers to a group of autosomal recessive disorders characterized by impaired salt reabsorption in the thick ascending loop of Henle with pronounced salt wasting, hypokalemic metabolic alkalosis, and varying degrees of hypercalciuria. BS2 is a life-threatening condition beginning in utero, with marked fetal polyuria that leads to polyhydramnios and premature delivery. Another hallmark of BS2 is a marked hypercalciuria and, as a secondary consequence, the development of nephrocalcinosis and osteopenia.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KCNJ1