KCNIP4 Antibody (1A11)

Images

 
Immunocytochemistry/ Immunofluorescence: KCNIP4 Antibody (1A11) [H00080333-M01] - Analysis of monoclonal antibody to KCNIP4 on HeLa cell . Antibody concentration 10 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
1A11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

KCNIP4 Antibody (1A11) Summary

Immunogen
KCNIP4 (AAH32520, 1 a.a. ~ 250 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MNVRRVESISAQLEEASSTGGFLYAQNSTKRSIKERLMKLLPCSAAKTSSPAIQNSVEDELEMATVRHRPEALELLEAQSKFTKKELQILYRGFKNECPSGVVNEETFKEIYSQFFPQGDSTTYAHFLFNAFDTDHNGAVSFEDFIKGLSILLRGTVQEKLNWAFNLYDINKDGYITKEEMLDIMKAIYDMMGKCTYPVLKEDAPRQHVETFFQKMDKNKDGVVTIDEFIESCQKDENIMRSMQLFENVI
Specificity
KCNIP4 - Kv channel interacting protein 4
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
KCNIP4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Western Blot 1:500
Application Notes
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for KCNIP4 Antibody (1A11)

  • A-type potassium channel modulatory protein 4
  • Calsenilin-like protein
  • KChIP4
  • KCHIP4CALPMGC44947
  • Kv channel interacting protein 4
  • Kv channel-interacting protein 4
  • potassium channel interacting protein 4
  • Potassium channel-interacting protein 4

Background

This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belong to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. This protein member also interacts with presenilin. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00030818-M01
Species: Hu
Applications: ELISA, ICC/IF, IP, S-ELISA, WB
NBP3-03748
Species: Hu, Rt
Applications: IHC, IHC-P, WB
NBP2-19020
Species: Bv, Hu, Mu, Po, Rt
Applications: WB
H00030819-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, KD, WB
NBP3-03750
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB100-74513
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
H00051176-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, KD, PLA, S-ELISA, WB
NB110-3638
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI, WB
AF1356
Species: Hu, Mu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
DPI00
Species: Hu
Applications: ELISA
NBP1-28870
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB
DCC270
Species: Hu
Applications: ELISA
NBP1-89134
Species: Hu
Applications: IHC, IHC-P
NBP1-89133
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-74510
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP2-32263
Species: Hu, Mu
Applications: IHC, IP, WB
NBP1-87525
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-43694
Species: Hu
Applications: ICC/IF, IP, WB
H00080333-M01
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for KCNIP4 Antibody (H00080333-M01) (0)

There are no publications for KCNIP4 Antibody (H00080333-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KCNIP4 Antibody (H00080333-M01) (0)

There are no reviews for KCNIP4 Antibody (H00080333-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for KCNIP4 Antibody (H00080333-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KCNIP4 Products

Bioinformatics Tool for KCNIP4 Antibody (H00080333-M01)

Discover related pathways, diseases and genes to KCNIP4 Antibody (H00080333-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KCNIP4 Antibody (H00080333-M01)

Discover more about diseases related to KCNIP4 Antibody (H00080333-M01).
 

Pathways for KCNIP4 Antibody (H00080333-M01)

View related products by pathway.

PTMs for KCNIP4 Antibody (H00080333-M01)

Learn more about PTMs related to KCNIP4 Antibody (H00080333-M01).
 

Research Areas for KCNIP4 Antibody (H00080333-M01)

Find related products by research area.

Blogs on KCNIP4

There are no specific blogs for KCNIP4, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KCNIP4 Antibody (1A11) and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNIP4
Entrez
OMIM
Uniprot