KCC2/SLC12A5 Recombinant Protein Antigen

Images

 
There are currently no images for KCC2/SLC12A5 Recombinant Protein Antigen (NBP2-49674PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

KCC2/SLC12A5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KCC2/SLC12A5.

Source: E. coli

Amino Acid Sequence: ILKQMHLTKNEREREIQSITDESRGSIRRKNPANTRLRLNVPEETAGDSEEKPEEEVQLIHDQSAPSC

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SLC12A5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49674.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for KCC2/SLC12A5 Recombinant Protein Antigen

  • Electroneutral potassium-chloride cotransporter 2
  • hKCC2
  • KCC2
  • KCC2K-Cl cotransporter 2
  • KIAA1176erythroid K-Cl cotransporter 2
  • Neuronal K-Cl cotransporter
  • SLC12A5
  • solute carrier family 12 (potassium/chloride transporter), member 5
  • solute carrier family 12 member 5

Background

K-Cl cotransporters are proteins that lower intracellular chloride concentrations below the electrochemical equilibrium potential. The protein encoded by this gene is an integral membrane K-Cl cotransporter that can function in either a net efflux or influx pathway, depending on the chemical concentration gradients of potassium and chloride. The encoded protein can act as a homomultimer, or as a heteromultimer with other K-Cl cotransporters, to maintain chloride homeostasis in neurons. Alternative splicing results in two transcript variants encoding different isoforms. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-52148
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA
NBP1-06043
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA, WB
DBD00
Species: Hu
Applications: ELISA
NBP1-89282
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
MAB9030
Species: Hu
Applications: CyTOF-ready, Flow
AF2086
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NBP1-88191
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP1-80993
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB110-41404
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
AF2247
Species: Hu
Applications: IHC, WB
MAB6495
Species: Hu
Applications: ICC, Simple Western, WB
NBP2-20857
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
AF2185
Species: Hu, Mu, Rt
Applications: IP, WB
NBP3-47902
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NBP1-32870
Species: Ch, Hu
Applications: IHC,  IHC-P, IP, KD, WB
NBP2-30949
Species: Hu
Applications: IHC,  IHC-P
NBP1-97512
Species: Mu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-44520
Species: Ca(-), Hu, Rt(-)
Applications: ICC/IF, IF, IHC,  IHC-P, MI, WB

Publications for KCC2/SLC12A5 Recombinant Protein Antigen (NBP2-49674PEP) (0)

There are no publications for KCC2/SLC12A5 Recombinant Protein Antigen (NBP2-49674PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KCC2/SLC12A5 Recombinant Protein Antigen (NBP2-49674PEP) (0)

There are no reviews for KCC2/SLC12A5 Recombinant Protein Antigen (NBP2-49674PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for KCC2/SLC12A5 Recombinant Protein Antigen (NBP2-49674PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional KCC2/SLC12A5 Products

Research Areas for KCC2/SLC12A5 Recombinant Protein Antigen (NBP2-49674PEP)

Find related products by research area.

Blogs on KCC2/SLC12A5

There are no specific blogs for KCC2/SLC12A5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our KCC2/SLC12A5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC12A5