KCC1/SLC12A4 Antibody (1H6)

Images

 
Western Blot: KCC1/SLC12A4 Antibody (1H6) [H00006560-M01] - Analysis of SLC12A4 expression in transfected 293T cell line by SLC12A4 monoclonal antibody (M01), clone 1H6.Lane 1: SLC12A4 transfected lysate(120.6 KDa).Lane ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1H6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

KCC1/SLC12A4 Antibody (1H6) Summary

Immunogen
SLC12A4 (AAH21193, 1 a.a. - 110 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPHFTVVPVDGPRRGDYDNLEGLSWVDYGERAELDDSDGHGNHRESSPFLSPLEASRGIDYYDRNLALFEEELDIRPKVSSLLGKLVSYTNLTQGAKEHEEAESGEGTRR
Localization
Membrane; Multi-pass membrane protein.
Specificity
SLC12A4 - solute carrier family 12 (potassium/chloride transporters), member 4
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SLC12A4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for KCC1/SLC12A4 Antibody (1H6)

  • Electroneutral potassium-chloride cotransporter 1
  • Erythroid K-Cl cotransporter 1
  • FLJ17069
  • FLJ40489
  • hKCC1
  • KCC1
  • KCC1erythroid K:Cl cotransporter
  • K-Cl cotransporter
  • potassium/chloride cotransporter 1
  • SLC12A4
  • solute carrier family 12 (potassium/chloride transporters), member 4
  • solute carrier family 12 member 4

Background

Potassium-chloride cotransporters mediate the coupled movement of potassium and chloride ions across the plasma membrane. SLC12A4 mediates electroneutral potassium-chloride cotransport when activated by cell swelling and may contribute to cell volume homeostasis in single cells. SLC12A4 may play a role in early erythroid maturation events.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89282
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB8369
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-85133
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB8528
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-86376
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-57622
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF2180
Species: Hu
Applications: WB, Simple Western, IP
640-A3
Species: Mu
NBP1-03340
Species: Hu
Applications: WB, IP
NBP2-33694
Species: Hu
Applications: IHC, IHC-P
NBP1-48021
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-31441
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-62178
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IP
MAB25031
Species: Hu
Applications: WB, IHC, IP

Publications for KCC1/SLC12A4 Antibody (H00006560-M01) (0)

There are no publications for KCC1/SLC12A4 Antibody (H00006560-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KCC1/SLC12A4 Antibody (H00006560-M01) (0)

There are no reviews for KCC1/SLC12A4 Antibody (H00006560-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KCC1/SLC12A4 Antibody (H00006560-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KCC1/SLC12A4 Products

Bioinformatics Tool for KCC1/SLC12A4 Antibody (H00006560-M01)

Discover related pathways, diseases and genes to KCC1/SLC12A4 Antibody (H00006560-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KCC1/SLC12A4 Antibody (H00006560-M01)

Discover more about diseases related to KCC1/SLC12A4 Antibody (H00006560-M01).
 

Pathways for KCC1/SLC12A4 Antibody (H00006560-M01)

View related products by pathway.

PTMs for KCC1/SLC12A4 Antibody (H00006560-M01)

Learn more about PTMs related to KCC1/SLC12A4 Antibody (H00006560-M01).

Blogs on KCC1/SLC12A4

There are no specific blogs for KCC1/SLC12A4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KCC1/SLC12A4 Antibody (1H6) and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC12A4
Entrez
OMIM
Uniprot