KBTBD10 Antibody - BSA Free

Immunohistochemistry-Paraffin: KBTBD10 Antibody [NBP1-80788] - Staining of human lymph node.

Immunohistochemistry-Paraffin: KBTBD10 Antibody [NBP1-80788] - Staining of human liver shows low expression as expected.

Immunohistochemistry-Paraffin: KBTBD10 Antibody [NBP1-80788] - Staining of human skeletal muscle shows high expression.

Immunohistochemistry-Paraffin: KBTBD10 Antibody [NBP1-80788] - Staining in human skeletal muscle and liver tissues using anti-KLHL41 antibody. Corresponding KLHL41 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: KBTBD10 Antibody [NBP1-80788] - Staining of human colon, liver, lymph node and skeletal muscle using Anti-KLHL41 antibody NBP1-80788 (A) shows similar protein distribution across tissues to independent antibody NBP1-80787 (B).

Immunohistochemistry-Paraffin: KBTBD10 Antibody [NBP1-80788] - Staining of human colon.

ChIP-Exo-Seq composite graph for Anti-KBTBD10 tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh's Lab at Cornell University.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

KBTBD10 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SNDSLNVEKEEAVFEAVMKWVRTDKENRVKNLSEVFDCIRFRLMTEKYFKDHVEKDDIIKSNPDLQK
• Predicted Species: Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KBTBD10
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  KBTBD10 Protein (NBP1-80788PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for KBTBD10 Antibody - BSA Free

• FLJ60989
• kelch repeat and BTB (POZ) domain containing 10
• kelch repeat and BTB domain-containing protein 10
• Kelch-related protein 1
• Kel-like protein 23
• KRP1
• Sarcosin
• SARCOSINsarcomeric muscle protein

Background

KBTBD10 is required for pseudopod elongation in transformed cells. Substrate-specific adapter of an E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for KBTBD10 Antibody (NBP1-80788)(2)

Publications using NBP1-80788

• Okpara MO, Hermann C, van der Watt PJ et al. A mass spectrometry-based approach for the identification of Kpn beta 1 binding partners in cancer cells Scientific reports 2022-11-23 [PMID: 36418423] (WB, Human)
  
  Details:
  Dilution of 1:1000 was used
• Mukhi D, Kolligundla LP, Maruvada S et al. Growth hormone induces transforming growth factor-beta 1 in podocytes: Implications in podocytopathy and proteinuria Biochimica et biophysica acta. Molecular cell research 2022-11-15 [PMID: 36400249] (WB, Human)

Bioinformatics

• Gene Symbol: KBTBD10
• Entrez:
  • 10324(Human)