KATNAL2 Antibody


Western Blot: KATNAL2 Antibody [NBP2-30844] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: KATNAL2 Antibody [NBP2-30844] - Staining of human testis shows strong nuclear membrane positivity in seminiferous ducts.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

KATNAL2 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: NNLPQRSRGKTRRMMNDSCQNLPKINQQRPRSKTTAGKTGDTKSLNKEHPNQEVVDNTRLENANFGLHISRIRK
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
KATNAL2 Protein (NBP2-30844PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for KATNAL2 Antibody

  • DKFZp667C165
  • EC
  • katanin p60 ATPase-containing subunit A-like 2
  • katanin p60 subunit A-like 2DKFZP667C165
  • MGC33211
  • p60 katanin-like 2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
Species: Hu
Applications: IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Species: Hu, Mu
Applications: WB (-), IHC-P, IP
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: WB, Flow, IHC, IHC-P

Publications for KATNAL2 Antibody (NBP2-30844) (0)

There are no publications for KATNAL2 Antibody (NBP2-30844).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KATNAL2 Antibody (NBP2-30844) (0)

There are no reviews for KATNAL2 Antibody (NBP2-30844). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KATNAL2 Antibody (NBP2-30844) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional KATNAL2 Products

Bioinformatics Tool for KATNAL2 Antibody (NBP2-30844)

Discover related pathways, diseases and genes to KATNAL2 Antibody (NBP2-30844). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KATNAL2 Antibody (NBP2-30844)

Discover more about diseases related to KATNAL2 Antibody (NBP2-30844).

Pathways for KATNAL2 Antibody (NBP2-30844)

View related products by pathway.

PTMs for KATNAL2 Antibody (NBP2-30844)

Learn more about PTMs related to KATNAL2 Antibody (NBP2-30844).

Research Areas for KATNAL2 Antibody (NBP2-30844)

Find related products by research area.

Blogs on KATNAL2

There are no specific blogs for KATNAL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our KATNAL2 Antibody and receive a gift card or discount.


Gene Symbol KATNAL2