KATNAL2 Antibody

Images

 
Western Blot: KATNAL2 Antibody [NBP2-30452] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: KATNAL2 Antibody [NBP2-30452] - Staining of human cell line U-2 OS shows localization to nucleoplasm & intermediate filaments.
Immunohistochemistry-Paraffin: KATNAL2 Antibody [NBP2-30452] - Staining of human testis shows strong positivity in a subset of cells in seminiferous ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KATNAL2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: NAHPRRGQIIDFQGLLTDAIKGATSELALNTFDHNPDPSERLLKPLSAFIGMNSEMRELAAVVSRDIYLHNPNIKWNDIIGLDA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KATNAL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
KATNAL2 Protein (NBP2-30452PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KATNAL2 Antibody

  • DKFZp667C165
  • EC 3.6.4.3
  • katanin p60 ATPase-containing subunit A-like 2
  • katanin p60 subunit A-like 2DKFZP667C165
  • MGC33211
  • p60 katanin-like 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-97719
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-49512
Species: Hu
Applications: IHC
NBP2-15142
Species: Hu
Applications: WB, IHC, IHC-P
NB100-60417
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP
NBP2-02450
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-05477
Species: Hu
NBP2-34980
Species: Hu
NB100-81665
Species: Hu, Mu
Applications: WB (-), IHC-P, IP
NBP2-05592
Species: Hu
NBP1-92025
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19819
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-13738
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85960
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55149
Species: Hu
Applications: ICC/IF
AF5094
Species: Hu, Mu, Rt
Applications: WB
NBP2-01151
Species: Hu
Applications: WB, Flow, IHC, IHC-P

Publications for KATNAL2 Antibody (NBP2-30452) (0)

There are no publications for KATNAL2 Antibody (NBP2-30452).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KATNAL2 Antibody (NBP2-30452) (0)

There are no reviews for KATNAL2 Antibody (NBP2-30452). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for KATNAL2 Antibody (NBP2-30452) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KATNAL2 Products

Bioinformatics Tool for KATNAL2 Antibody (NBP2-30452)

Discover related pathways, diseases and genes to KATNAL2 Antibody (NBP2-30452). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KATNAL2 Antibody (NBP2-30452)

Discover more about diseases related to KATNAL2 Antibody (NBP2-30452).
 

Pathways for KATNAL2 Antibody (NBP2-30452)

View related products by pathway.

PTMs for KATNAL2 Antibody (NBP2-30452)

Learn more about PTMs related to KATNAL2 Antibody (NBP2-30452).
 

Research Areas for KATNAL2 Antibody (NBP2-30452)

Find related products by research area.

Blogs on KATNAL2

There are no specific blogs for KATNAL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KATNAL2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KATNAL2
Uniprot