![Western Blot: KATNAL2 Antibody [NBP2-30452] - Analysis in human cell lines A-549 and Caco-2. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.](http://images.novusbio.com/fullsize/KATNAL2-Antibody-Western-Blot-NBP2-30452-img0006.jpg "Western Blot: KATNAL2 Antibody [NBP2-30452] - Analysis in human cell lines A-549 and Caco-2. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit KATNAL2 Antibody - BSA Free (NBP2-30452) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: NAHPRRGQIIDFQGLLTDAIKGATSELALNTFDHNPDPSERLLKPLSAFIGMNSEMRELAAVVSRDIYLHNPNIKWNDIIGLDA |
| Predicted Species | Mouse (92%), Rat (94%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | KATNAL2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for KATNAL2 Antibody (NBP2-30452)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: KATNAL2 Antibody [NBP2-30452] - Staining of human cell line U-2 OS shows localization to nucleoplasm & intermediate filaments.](http://images.novusbio.com/fullsize/KATNAL2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-30452-img0004.jpg "Immunocytochemistry/Immunofluorescence: KATNAL2 Antibody [NBP2-30452] - Staining of human cell line U-2 OS shows localization to nucleoplasm & intermediate filaments.")
![Immunohistochemistry-Paraffin: KATNAL2 Antibody [NBP2-30452] - Staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/KATNAL2-Antibody-Immunohistochemistry-Paraffin-NBP2-30452-img0010.jpg "Immunohistochemistry-Paraffin: KATNAL2 Antibody [NBP2-30452] - Staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: KATNAL2 Antibody [NBP2-30452] - Staining of human testis shows strong positivity in a subset of cells in seminiferous ducts.](http://images.novusbio.com/fullsize/KATNAL2-Antibody-Immunohistochemistry-Paraffin-NBP2-30452-img0005.jpg "Immunohistochemistry-Paraffin: KATNAL2 Antibody [NBP2-30452] - Staining of human testis shows strong positivity in a subset of cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: KATNAL2 Antibody [NBP2-30452] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/KATNAL2-Antibody-Immunohistochemistry-Paraffin-NBP2-30452-img0007.jpg "Immunohistochemistry-Paraffin: KATNAL2 Antibody [NBP2-30452] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.")
![Immunohistochemistry-Paraffin: KATNAL2 Antibody [NBP2-30452] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/KATNAL2-Antibody-Immunohistochemistry-Paraffin-NBP2-30452-img0008.jpg "Immunohistochemistry-Paraffin: KATNAL2 Antibody [NBP2-30452] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: KATNAL2 Antibody [NBP2-30452] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.](http://images.novusbio.com/fullsize/KATNAL2-Antibody-Immunohistochemistry-Paraffin-NBP2-30452-img0009.jpg "Immunohistochemistry-Paraffin: KATNAL2 Antibody [NBP2-30452] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.")
![Bioactivity IBSP/Sialoprotein II [Unconjugated]](https://images.novusbio.com/images/4014-sp_recombinant-human-ibsp-sialoprotein-ii-protein-cf-bioactivity-4420249391..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")