We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

katanin-p80 Recombinant Protein Antigen

Images

 
There are currently no images for katanin-p80 Protein (NBP1-87503PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

katanin-p80 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KATNB1.

Source: E. coli

Amino Acid Sequence: FHPNEYLLASGSSDRTIRFWDLEKFQVVSCIEGEPGPVRSVLFNPDGCCLYSGCQDSLRVYGWEPERCFDVVLVNWGKVADLAICNDQLIGVAFSQSNVSSY

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KATNB1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87503.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for katanin-p80 Recombinant Protein Antigen

  • KAT
  • katanin (80 kDa)
  • katanin p80 (WD repeat containing) subunit B 1
  • katanin p80 (WD40-containing) subunit B 1
  • Katanin p80 subunit B1
  • katanin p80 WD40-containing subunit B1
  • p80 katanin

Background

Microtubules, polymers of alpha and beta tubulin subunits, form the mitotic spindle of a dividing cell and help toorganize membranous organelles during interphase. Katanin is a heterodimer that consists of a 60 kDa ATPase (p60subunit A 1) and an 80 kDa accessory protein (p80 subunit B 1). The p60 subunit acts to sever and disassemblemicrotubules, while the p80 subunit targets the enzyme to the centrosome. Katanin is a member of the AAA family ofATPases. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89627
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-86335
Species: Hu
Applications: IHC,  IHC-P
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NB100-381
Species: Hu
Applications: ChIP, IP, WB
NB110-41404
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
DVE00
Species: Hu
Applications: ELISA
NB100-616
Species: Hu, Mu, Md, Pm, Rt
Applications: ChIP, EM, Flow-IC, Flow, ICC/IF, IP, In vitro, KD, WB
NBP1-47761
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP3-37988
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB100-74503
Species: Mu, Rt
Applications: ICC/IF, WB
NB500-487
Species: Bv, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP3-09392
Species: Hu, Mu
Applications: WB
NBP3-32740
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-93574
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-76729
Species: Hu
Applications: ELISA, ICC/IF, WB
MAB6734
Species: Hu
Applications: IHC
MAB3228
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
NBP1-85482
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NLS3775
Species: Hu, Pm
Applications: ICC/IF, IHC,  IHC-P
NBP1-87503PEP
Species: Hu
Applications: AC

Publications for katanin-p80 Protein (NBP1-87503PEP) (0)

There are no publications for katanin-p80 Protein (NBP1-87503PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for katanin-p80 Protein (NBP1-87503PEP) (0)

There are no reviews for katanin-p80 Protein (NBP1-87503PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for katanin-p80 Protein (NBP1-87503PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional katanin-p80 Products

Research Areas for katanin-p80 Protein (NBP1-87503PEP)

Find related products by research area.

Blogs on katanin-p80

There are no specific blogs for katanin-p80, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our katanin-p80 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol KATNB1