We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Karyopherin (importin) beta 3 Recombinant Protein Antigen

Images

 
There are currently no images for Karyopherin (importin) beta 3 Protein (NBP2-38480PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Karyopherin (importin) beta 3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IPO5.

Source: E. coli

Amino Acid Sequence: AAEQQQFYLLLGNLLSPDNVVRKQAEETYEN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
IPO5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38480.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Karyopherin (importin) beta 3 Recombinant Protein Antigen

  • DKFZp686O1576
  • FLJ43041
  • IMB3
  • imp5
  • importin 5
  • importin beta-3 subunit
  • Importin subunit beta-3
  • importin-5
  • karyopherin (importin) beta 3
  • Karyopherin beta-3
  • KPNB3
  • MGC2068
  • RAN binding protein 5
  • Ran_GTP binding protein 5
  • Ran-binding protein 5
  • RANBP5

Background

Nucleocytoplasmic transport, a signal- and energy-dependent process, takes place through nuclear pore complexes embedded in the nuclear envelope. The import of proteins containing a nuclear localization signal (NLS) requires the NLS import receptor, a heterodimer of importin alpha and beta subunits also known as karyopherins. Importin alpha binds the NLS-containing cargo in the cytoplasm and importin beta docks the complex at the cytoplasmic side of the nuclear pore complex. In the presence of nucleoside triphosphates and the small GTP binding protein Ran, the complex moves into the nuclear pore complex and the importin subunits dissociate. Importin alpha enters the nucleoplasm with its passenger protein and importin beta remains at the pore. Interactions between importin beta and the FG repeats of nucleoporins are essential in translocation through the pore complex. The protein encoded by this gene is a member of the importin beta family.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-61832
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-27150
Species: Hu, Pm, Rt
Applications: IHC,  IHC-P, In vitro, WB
NB400-148
Species: ChHa, Ha, Hu, Mu, Po, Pm, Rt
Applications: EM, ICC/IF, IHC,  IHC-P, IP, KD, KO, WB
NB100-79814
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NBP2-01763
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP3-46899
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-46518
Species: Hu
Applications: IHC,  IHC-P, WB
NB100-79833
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
H00002038-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-01245
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB110-68133
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-83213
Species: Hu
Applications: IHC,  IHC-P, WB
NB100-82245
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, KD, Simple Western, WB
NLS3775
Species: Hu, Pm
Applications: ICC/IF, IHC,  IHC-P
NB100-79802
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
NB100-93322
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-00175
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, PEP-ELISA, Simple Western, WB

Publications for Karyopherin (importin) beta 3 Protein (NBP2-38480PEP) (0)

There are no publications for Karyopherin (importin) beta 3 Protein (NBP2-38480PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Karyopherin (importin) beta 3 Protein (NBP2-38480PEP) (0)

There are no reviews for Karyopherin (importin) beta 3 Protein (NBP2-38480PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Karyopherin (importin) beta 3 Protein (NBP2-38480PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Karyopherin (importin) beta 3 Products

Blogs on Karyopherin (importin) beta 3

There are no specific blogs for Karyopherin (importin) beta 3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Karyopherin (importin) beta 3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol IPO5