Kallikrein 8/Neuropsin Antibody - BSA Free

Immunohistochemistry-Paraffin: Kallikrein 8/Neuropsin Antibody [NBP3-05517] - Analysis in human esophagus and colon tissues using Anti-KLK8 antibody. Corresponding KLK8 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Kallikrein 8/Neuropsin Antibody [NBP3-05517] - Staining of human colon shows low expression as expected.

Immunohistochemistry-Paraffin: Kallikrein 8/Neuropsin Antibody [NBP3-05517] - Staining of human esophagus shows high expression.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Kallikrein 8/Neuropsin Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Kallikrein 8/Neuropsin Antibody - BSA Free (NBP3-05517) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GSKVKPISLADHCTQPGQKCTVSGWGTVTSPRENFPDTLNCAEVKIFPQKKCEDAYPGQITDGMVCAGSSKGADTCEGDSGG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KLK8
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, containing 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Kallikrein 8/Neuropsin Antibody - BSA Free

• EC 3.4.21
• EC 3.4.21.118
• hK8
• HNP
• kallikrein 8 (neuropsin/ovasin)
• Kallikrein 8
• kallikrein-related peptidase 8
• KLK8 protein type 1
• KLK8 protein type 2
• KLK8
• neuropsin type 1
• neuropsin type 2
• Neuropsin
• NP
• NRPN
• Ovasin
• PRSS19
• PRSS19kallikrein-8
• Serine protease 19
• Serine protease TADG-14
• TADG14neuropsin
• Tumor-associated differentially expressed gene 14 protein

Background

Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Alternate splicing of this gene results in four transcript variants encoding four different isoforms. The isoforms exhibit distinct patterns of expression that suggest roles in brain plasticity and ovarian cancer.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KLK8