Kallikrein 8/Neuropsin Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit Kallikrein 8/Neuropsin Antibody - BSA Free (NBP3-05517) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: GSKVKPISLADHCTQPGQKCTVSGWGTVTSPRENFPDTLNCAEVKIFPQKKCEDAYPGQITDGMVCAGSSKGADTCEGDSGG |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
KLK8 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, pH 7.2, containing 40% glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Kallikrein 8/Neuropsin Antibody - BSA Free
Background
Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Alternate splicing of this gene results in four transcript variants encoding four different isoforms. The isoforms exhibit distinct patterns of expression that suggest roles in brain plasticity and ovarian cancer.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IP, WB
Species: Bt, Bv, Ca, Eq, Hu, Pm, Mu, Rb
Applications: IHC, IHC-P
Species: Hu
Applications: IP, WB
Species: Hu, Mu
Applications: IHC, IP, WB
Species: Hu
Applications: EnzAct
Species: Hu
Applications: ELISA
Species: Hu
Applications: EnzAct
Species: Hu
Applications: EnzAct
Species: Hu
Applications: ELISA
Species: Hu
Applications: IHC, IP, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IP, Neut, WB
Species: Hu, Pm, Mu
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
Species: Hu
Applications: IHC
Publications for Kallikrein 8/Neuropsin Antibody (NBP3-05517) (0)
There are no publications for Kallikrein 8/Neuropsin Antibody (NBP3-05517).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Kallikrein 8/Neuropsin Antibody (NBP3-05517) (0)
There are no reviews for Kallikrein 8/Neuropsin Antibody (NBP3-05517).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Kallikrein 8/Neuropsin Antibody (NBP3-05517) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Kallikrein 8/Neuropsin Products
Research Areas for Kallikrein 8/Neuropsin Antibody (NBP3-05517)
Find related products by research area.
|
Blogs on Kallikrein 8/Neuropsin