KAL1 Antibody (2E8)

Images

 
Sandwich ELISA: KAL1 Antibody (2E8) [H00003730-M01] - Detection limit for recombinant GST tagged KAL1 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, HaSpecies Glossary
Applications WB, ELISA, ICC/IF, S-ELISA
Clone
2E8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

KAL1 Antibody (2E8) Summary

Immunogen
KAL1 (NP_000207, 548 a.a. ~ 657 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LAKPENLSASFIVQDVNITGHFSWKMAKANLYQPMTGFQVTWAEVTTESRQNSLPNSIISQSQILPSDHYVLTVPNLRPSTLYRLEVQVLTPGGEGPATIKTFRTPELPP
Specificity
KAL1 - Kallmann syndrome 1 sequence
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ANOS1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Sandwich ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publications using H00003730-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for KAL1 Antibody (2E8)

  • Adhesion molecule-like X-linked
  • ADMLXHHA
  • anosmin-1
  • KAL
  • KALIG1
  • KALIG-1
  • Kallmann syndrome 1 sequence
  • Kallmann syndrome interval gene 1
  • Kallmann syndrome protein
  • Kallmann syndrome-1 sequence (anosmin-1)
  • KMS

Background

Mutations in this gene cause the X-linked Kallmann syndrome. The encoded protein is similar in sequence to proteins known to function in neural cell adhesion and axonal migration. In addition, this cell surface protein is N-glycosylated and may have anti-protease activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-1287
Species: Hu, Mu, Rt, Rb
Applications: WB, Flow, IHC, IP, CyTOF-ready
NBP1-45218
Species: Hu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-43853
Species: Hu, Mu, Rt, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-45298
Species: Hu, Rt
Applications: WB, Flow, IHC, IHC-P, IF
NBP1-84730
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NLS1927
Species: Hu, Po, Bv, Gt
Applications: IHC, IHC-P
NBP2-38770
Species: Hu, Mu
Applications: WB
NBP1-91258
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB35661
Species: Hu
Applications: WB, IHC, IP, Neut
NBP1-77393
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57016
Species: Hu
Applications: WB
H00003077-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
NB300-506
Species: Mu, Am
Applications: ICC/IF, IHC, IHC-P

Publications for KAL1 Antibody (H00003730-M01)(2)

Reviews for KAL1 Antibody (H00003730-M01) (0)

There are no reviews for KAL1 Antibody (H00003730-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for KAL1 Antibody (H00003730-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional KAL1 Products

Bioinformatics Tool for KAL1 Antibody (H00003730-M01)

Discover related pathways, diseases and genes to KAL1 Antibody (H00003730-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KAL1 Antibody (H00003730-M01)

Discover more about diseases related to KAL1 Antibody (H00003730-M01).
 

Pathways for KAL1 Antibody (H00003730-M01)

View related products by pathway.

PTMs for KAL1 Antibody (H00003730-M01)

Learn more about PTMs related to KAL1 Antibody (H00003730-M01).

Blogs on KAL1

There are no specific blogs for KAL1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KAL1 Antibody (2E8) and receive a gift card or discount.

Bioinformatics

Gene Symbol ANOS1
Entrez
OMIM
Uniprot