Recombinant Human JunB/AP-1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human JunB/AP-1 Protein Summary

Description
JunB/AP-1 (Human) GST-Tagged Recombinant Protein

Source: Wheat Germ (in vitro)

Amino Acid Sequence: GQGSDTGASLKLASSELERLIVPNSNGVITTTPTPPGQYFYPRGGGSGGGAGGAGGGVTEEQEGFADGFVKALDDLHKMNHVTPPNVSLG
Protein/Peptide Type
Partial Recombinant Protein
Gene
JUNB

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human JunB/AP-1 Protein

  • activator protein 1
  • AP-1
  • jun B proto-oncogene
  • JunB
  • transcription factor jun-B

Background

JUNB - jun B proto-oncogene

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
7270-IL/CF
Species: Hu
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47757
Species: Hu
Applications: WB, IHC, IHC-P
NB100-410
Species: Hu, Mu
Applications: WB, IP
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)

Publications for JunB/AP-1 Partial Recombinant Protein (H00003726-Q01) (0)

There are no publications for JunB/AP-1 Partial Recombinant Protein (H00003726-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for JunB/AP-1 Partial Recombinant Protein (H00003726-Q01) (0)

There are no reviews for JunB/AP-1 Partial Recombinant Protein (H00003726-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for JunB/AP-1 Partial Recombinant Protein (H00003726-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional JunB/AP-1 Products

Bioinformatics Tool for JunB/AP-1 Partial Recombinant Protein (H00003726-Q01)

Discover related pathways, diseases and genes to JunB/AP-1 Partial Recombinant Protein (H00003726-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for JunB/AP-1 Partial Recombinant Protein (H00003726-Q01)

Discover more about diseases related to JunB/AP-1 Partial Recombinant Protein (H00003726-Q01).
 

Pathways for JunB/AP-1 Partial Recombinant Protein (H00003726-Q01)

View related products by pathway.

PTMs for JunB/AP-1 Partial Recombinant Protein (H00003726-Q01)

Learn more about PTMs related to JunB/AP-1 Partial Recombinant Protein (H00003726-Q01).

Blogs on JunB/AP-1

There are no specific blogs for JunB/AP-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-6 [Unconjugated]
7270-IL-025/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human JunB/AP-1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol JUNB
Entrez