JSRP1 Antibody (6A9) - Azide and BSA Free Summary
| Description |
Novus Biologicals Mouse JSRP1 Antibody (6A9) - Azide and BSA Free (H00126306-M02-100ug) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
JSRP1 (NP_653217.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSMTTRAWEELDGGLGSCQALEDHSALAETQEDRASATPRLADSGSVPHDSQVAEGPSVDTRPKKMEKEPAARGTPGTGKERLKAGASPRSVPARKKAQT |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
JSRP1 |
| Purity |
Protein A or G purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
Protein A or G purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for JSRP1 Antibody (6A9) - Azide and BSA Free
Background
The junction between the transverse tubules (T-tubules) and the sarcoplasmic reticulum (SR) of skeletal muscle is called the triad. At the triad, dihydropyridine receptors (DHPR®s) of the T-tubule serve as voltage sensors in excitation-contraction coupling, while ryanodine receptors (RyR®s), the calcium release channels, exist in the membrane of the terminal cisternae of the SR. It is thought that during slow phase depolarization of the T-tubule, a third protein, triadin (95 kDa) transmits electrochemical signals to the SR through direct interaction with both DHPR®s and RyR®s. Another skeletal muscle specific 90 kDa protein has also been localized to the this junction. This protein is phosphorylated by an intrinsic protein kinase in triads suggesting that it may play an important regulatory or structural role in the skeletal muscle triad junction.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Gp, Hu, Mu, Rb, Rt
Applications: Flow, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Am, Bv, Ca, Ma, Fi, Hu, Ma-Mn, Mu, Pm, Rb, Rt, Sh
Applications: B/N, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: ELISA, IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB, ELISA
Publications for JSRP1 Antibody (H00126306-M02-100ug) (0)
There are no publications for JSRP1 Antibody (H00126306-M02-100ug).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for JSRP1 Antibody (H00126306-M02-100ug) (0)
There are no reviews for JSRP1 Antibody (H00126306-M02-100ug).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for JSRP1 Antibody (H00126306-M02-100ug) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional JSRP1 Products
Array H00126306-M02-100ug
Blogs on JSRP1