JNK/JIP3 Recombinant Protein Antigen

Images

 
There are currently no images for JNK/JIP3 Protein (NBP2-38490PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

JNK/JIP3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MAPK8IP3.

Source: E. coli

Amino Acid Sequence: LDSDVNPEDPGADGVLAGITLVGCATRCNVPRSNCSSRGDTPVLDKGQGEVATIANGKVNPSQSTEEATEATEVPDPGPSEPETATLRPGPLTEHVFTDPA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MAPK8IP3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38490.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for JNK/JIP3 Recombinant Protein Antigen

  • C-jun-amino-terminal kinase interacting protein 3
  • C-Jun-amino-terminal kinase-interacting protein 3
  • DKFZp762N1113
  • homolog of Drosophila Sunday driver 2
  • JIP-3
  • JIP3FLJ00027
  • JNK MAP kinase scaffold protein 3
  • JNK/SAPK-associated protein-1
  • JNK/stress-activated protein kinase-associated protein 1
  • JNK-interacting protein 3
  • JSAP1
  • KIAA1066SYD2
  • mitogen-activated protein kinase 8 interacting protein 3
  • Mitogen-activated protein kinase 8-interacting protein 3
  • syd

Background

c-Jun NH2-terminal kinases (JNKs) are distant members of the MAP kinase family. JNK1 is activated by dual phosphorylation at a Thr-Pro-Tyr motif in response to ultraviolet (UV) light, and it functions to phosphorylate c-Jun at amino terminal serine regulatory sites Ser 63 and Ser 73, resulting in transcriptional activation. Two additional JNK family members, JNK2 and JNK3, have been identified. JIP-1 (for JNK interacting protein-1) has been identified as a cytoplasmic inhibitor of JNK that retains JNK in the cytoplasm, thereby inhibiting JNK-regulated gene expression. Evidence suggests that JNK1 and JNK2 bind to JIP-1 with greater affinity than to ATF-2 and c-Jun, which are targets of the JNK signaling pathway. JIP-1 contains an amino terminal JNK binding domain and a carboxy terminal SH3 domain. ATF-2 and c-Jun also contain the JNK binding domain and are thought to compete with JIP-1 for JNK binding. Multiple splice variants of JIP-1, including JIP-1b, JIP-1c (also designated islet-brain 1 or IB-1), JIP-2a, JIP-2b and JIP-3, have been identified in brain.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-48284
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-26149
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, WB
NBP2-72710
Species: Ca, Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, IP, WB
MAB1846
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
NBP1-85393
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-67327
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
AF4366
Species: Hu, Mu, Rt
Applications: WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP2-41263
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-31411
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
AF8691
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
AF2097
Species: Hu
Applications: ChIP, ICC, WB
NBP3-02962
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-22348
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IP, WB
NBP2-37542
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-38490PEP
Species: Hu
Applications: AC

Publications for JNK/JIP3 Protein (NBP2-38490PEP) (0)

There are no publications for JNK/JIP3 Protein (NBP2-38490PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for JNK/JIP3 Protein (NBP2-38490PEP) (0)

There are no reviews for JNK/JIP3 Protein (NBP2-38490PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for JNK/JIP3 Protein (NBP2-38490PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional JNK/JIP3 Products

Blogs on JNK/JIP3

There are no specific blogs for JNK/JIP3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our JNK/JIP3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MAPK8IP3