JMJD1B Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human JMJD1B. Source: E. coli Amino Acid Sequence: TLSSSPTEERPTVGPGQQDNPLLKTFSNVFGRHSGGFLSSPADFSQENKAPFEAVKRFSLDERSLACRQDSDSST Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
KDM3B |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58143. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
26 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for JMJD1B Recombinant Protein Antigen
Background
JMJD1B is a member of the jumonji (jmj) domain containing gene family of histone demethylases that plays a role in chromatin regulation and influences transcriptional activation and suppression. Some recently characterized members of the jmj family include JARID1A/RBP2, JARID1C, JMJD1A, JMJD1B, JMJD1C, JMJD2A, JMJD2C and JMJD2D. JMJD1B was identified as the 5qNCA gene that lies within a locus on chromosome 5 that is frequently deleted in myeloid leukemias and myelodysplasias. JMJD1B has been demonstrated to have growth suppressive activity and is implicated as a tumor suppressor gene. Alternate names for JMJD1B include JmjC domain-containing histone demethylation protein 2B, jumonji domain-containing protein 1B, nuclear protein 5qNCA, c5orf7, JHDM2B, and KIAA1082.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IP, KO, WB
Species: Hu, Mu
Applications: ICC/IF, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
Species: Hu, Mu
Applications: ChIP, ChIP, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
Species: Hu
Applications: ICC, WB
Species: Hu, Mu
Applications: IP, KD, WB
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Ec
Applications: EnzAct
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: AC
Publications for JMJD1B Recombinant Protein Antigen (NBP2-58143PEP) (0)
There are no publications for JMJD1B Recombinant Protein Antigen (NBP2-58143PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for JMJD1B Recombinant Protein Antigen (NBP2-58143PEP) (0)
There are no reviews for JMJD1B Recombinant Protein Antigen (NBP2-58143PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for JMJD1B Recombinant Protein Antigen (NBP2-58143PEP) (0)
Additional JMJD1B Products
Research Areas for JMJD1B Recombinant Protein Antigen (NBP2-58143PEP)
Find related products by research area.
|
Blogs on JMJD1B