JMJD1B Recombinant Protein Antigen

Images

 
There are currently no images for JMJD1B Recombinant Protein Antigen (NBP2-58143PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

JMJD1B Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human JMJD1B.

Source: E. coli

Amino Acid Sequence: TLSSSPTEERPTVGPGQQDNPLLKTFSNVFGRHSGGFLSSPADFSQENKAPFEAVKRFSLDERSLACRQDSDSST

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KDM3B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58143.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for JMJD1B Recombinant Protein Antigen

  • C5orf7
  • EC 1.14.11
  • EC 1.14.11.-
  • EC 1.14.11.65
  • JHDM2B
  • JmjC domain-containing histone demethylation protein 2B
  • JMJD1B
  • jumonji domain containing 1B
  • Jumonji domain-containing protein 1B
  • KDM3B
  • KIAA1082
  • KIAA1082chromosome 5 open reading frame 7
  • lysine (K)-specific demethylase 3B
  • lysine-specific demethylase 3B
  • NET22,5qNCA
  • Nuclear protein 5qNCA

Background

JMJD1B is a member of the jumonji (jmj) domain containing gene family of histone demethylases that plays a role in chromatin regulation and influences transcriptional activation and suppression. Some recently characterized members of the jmj family include JARID1A/RBP2, JARID1C, JMJD1A, JMJD1B, JMJD1C, JMJD2A, JMJD2C and JMJD2D. JMJD1B was identified as the 5qNCA gene that lies within a locus on chromosome 5 that is frequently deleted in myeloid leukemias and myelodysplasias. JMJD1B has been demonstrated to have growth suppressive activity and is implicated as a tumor suppressor gene. Alternate names for JMJD1B include JmjC domain-containing histone demethylation protein 2B, jumonji domain-containing protein 1B, nuclear protein 5qNCA, c5orf7, JHDM2B, and KIAA1082.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-77282
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IP, KO, WB
NB110-40585
Species: Hu, Mu
Applications: ICC/IF, IP, WB
NBP1-77072
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
AF1759
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
NBP1-49600
Species: Hu, Mu
Applications: ChIP, ChIP, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
AF2818
Species: Hu
Applications: ICC, WB
NB100-74605
Species: Hu, Mu
Applications: IP, KD, WB
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC,  IHC-P, WB
NBP2-24672
Species: Hu
Applications: WB
NBP1-32695
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NB100-86989
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NB500-487
Species: Bv, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP3-38210
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-47291
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
1670-SE
Species: Ec
Applications: EnzAct
288-TPN/CF
Species: Hu
Applications: BA
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-58143PEP
Species: Hu
Applications: AC

Publications for JMJD1B Recombinant Protein Antigen (NBP2-58143PEP) (0)

There are no publications for JMJD1B Recombinant Protein Antigen (NBP2-58143PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for JMJD1B Recombinant Protein Antigen (NBP2-58143PEP) (0)

There are no reviews for JMJD1B Recombinant Protein Antigen (NBP2-58143PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for JMJD1B Recombinant Protein Antigen (NBP2-58143PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional JMJD1B Products

Array NBP2-58143PEP

Research Areas for JMJD1B Recombinant Protein Antigen (NBP2-58143PEP)

Find related products by research area.

Blogs on JMJD1B

There are no specific blogs for JMJD1B, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our JMJD1B Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol KDM3B