Recombinant Human JM4 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human JM4 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-178 of Human PRAF2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSEVRLPPLRALDDFVLGSARLAAPDPCDPQRWCHRVINNLLYYQTNYLLCFGIGLALAGYVRPLHTLLSALVVAVALGVLVWAAETRAAVRRCRRSHPAACLAAVLAVGLLVLWVAGGACTFLFSIAGPVLLILVHASLRLRNLKNKIENKIESIGLKRTPMGLLLEALGQEQEAGS

Protein/Peptide Type
Recombinant Protein
Gene
PRAF2

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human JM4 Protein

  • FLJ57916
  • Jena-Muenchen 4
  • JM4
  • PRA1 domain family 2
  • PRA1 domain family, member 2
  • PRA1 family protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1105
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-80883
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84938
Species: Hu
Applications: IHC, IHC-P
MAB182
Species: Hu
Applications: Flow, CyTOF-ready, ICC, Neut
NBP1-89867
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1965
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, GP, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
AF755
Species: Mu
Applications: WB, Block
H00004830-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB200-109
Species: Hu, Mu
Applications: WB, ChIP, Flow, GS, ICC/IF, IP, CyTOF-ready
NB600-507
Species: Hu, Mu
Applications: WB, PEP-ELISA
NBP1-89827
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-06542
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-02149
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
H00011230-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for JM4 Recombinant Protein (H00011230-P01) (0)

There are no publications for JM4 Recombinant Protein (H00011230-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for JM4 Recombinant Protein (H00011230-P01) (0)

There are no reviews for JM4 Recombinant Protein (H00011230-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for JM4 Recombinant Protein (H00011230-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional JM4 Products

Bioinformatics Tool for JM4 Recombinant Protein (H00011230-P01)

Discover related pathways, diseases and genes to JM4 Recombinant Protein (H00011230-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for JM4 Recombinant Protein (H00011230-P01)

Discover more about diseases related to JM4 Recombinant Protein (H00011230-P01).
 

Pathways for JM4 Recombinant Protein (H00011230-P01)

View related products by pathway.

PTMs for JM4 Recombinant Protein (H00011230-P01)

Learn more about PTMs related to JM4 Recombinant Protein (H00011230-P01).

Blogs on JM4

There are no specific blogs for JM4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

JM4 Antibody
NBP1-87886

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human JM4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PRAF2