JIP2 Antibody


Immunohistochemistry: JIP2 Antibody [NBP1-89638] - Staining of human kidney shows distinct cytoplasmic positivity in tubule cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

JIP2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:FSLSTFHSLSPPGCRPPQDISLEEFDDEDLSEITDDCGLGLSYDSDHCEKDSLSLGRSEQPHPICSFQDDFQEFEM
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
JIP2 Protein (NBP1-89638PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for JIP2 Antibody

  • C-Jun-amino-terminal kinase-interacting protein 2
  • homologous to mouse JIP-1
  • IB-2
  • IB2JIP2Mitogen-activated protein kinase 8-interacting protein 2
  • islet-brain 2
  • islet-brain-2
  • JIP-2
  • JNK MAP kinase scaffold protein 2
  • JNK MAP kinase scaffold protein JIP2
  • JNK-interacting protein 2
  • mitogen-activated protein kinase 8 interacting protein 2
  • PRKM8 interacting protein-like


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: WB
Species: Hu
Applications: IP (-), WB
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA
Species: Hu
Applications: WB, ChIP, ICC
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
Species: Hu
Applications: ICC/IF
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for JIP2 Antibody (NBP1-89638) (0)

There are no publications for JIP2 Antibody (NBP1-89638).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for JIP2 Antibody (NBP1-89638) (0)

There are no reviews for JIP2 Antibody (NBP1-89638). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for JIP2 Antibody (NBP1-89638) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional JIP2 Products

Bioinformatics Tool for JIP2 Antibody (NBP1-89638)

Discover related pathways, diseases and genes to JIP2 Antibody (NBP1-89638). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for JIP2 Antibody (NBP1-89638)

Discover more about diseases related to JIP2 Antibody (NBP1-89638).

Pathways for JIP2 Antibody (NBP1-89638)

View related products by pathway.

PTMs for JIP2 Antibody (NBP1-89638)

Learn more about PTMs related to JIP2 Antibody (NBP1-89638).

Research Areas for JIP2 Antibody (NBP1-89638)

Find related products by research area.

Blogs on JIP2

There are no specific blogs for JIP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our JIP2 Antibody and receive a gift card or discount.


Gene Symbol MAPK8IP2