JAMP Recombinant Protein Antigen

Images

 
There are currently no images for JAMP Recombinant Protein Antigen (NBP2-57393PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

JAMP Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human JAMP.

Source: E. coli

Amino Acid Sequence: TFRRPMAVDIQPACLGLYCGKTLLFKNGSTEIYGECGVCPRGQRTNAQKYCQPCTESPELYD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
JKAMP
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57393.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for JAMP Recombinant Protein Antigen

  • C14orf100
  • chromosome 14 open reading frame 100
  • HSPC213
  • HSPC327
  • JAMPCDA06
  • JNK1/MAPK8-associated membrane protein
  • JNK1-associated membrane protein
  • JNK-associated membrane protein
  • Jun N-terminal kinase 1-associated membrane protein
  • Medulloblastoma antigen MU-MB-50.4

Background

JAMP may be a regulator of the duration of MAPK8 activity in response to various stress stimuli. Facilitates degradation of misfolded endoplasmic reticulum (ER) luminal proteins through the recruitment of components of the proteasome and endoplasmic reticulum-

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
MAB25031
Species: Hu
Applications: IHC, IP, WB
NBP1-88309
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1558
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-Fr, IP, WB
NB100-1483
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, PEP-ELISA, PLA, WB
NBP1-85311
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
AF1513
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
NBP1-76593
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB110-40591
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-43772
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-94913
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-31001
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
7268-CT
Species: Hu
Applications: BA
NB100-2595
Species: Hu
Applications: IHC, IHC-P, IP, WB
H00006045-M01
Species: Hu, I, Mu
Applications: ELISA, ICC/IF, KD, S-ELISA, WB
NB400-114
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
H00009223-M03
Species: Ca, Ha, Hu, Rt
Applications: ELISA, ICC/IF, WB
MAB1846
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
AF1107
Species: Mu
Applications: IHC, WB
NBP2-57393PEP
Species: Hu
Applications: AC

Publications for JAMP Recombinant Protein Antigen (NBP2-57393PEP) (0)

There are no publications for JAMP Recombinant Protein Antigen (NBP2-57393PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for JAMP Recombinant Protein Antigen (NBP2-57393PEP) (0)

There are no reviews for JAMP Recombinant Protein Antigen (NBP2-57393PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for JAMP Recombinant Protein Antigen (NBP2-57393PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional JAMP Products

Bioinformatics Tool for JAMP Recombinant Protein Antigen (NBP2-57393PEP)

Discover related pathways, diseases and genes to JAMP Recombinant Protein Antigen (NBP2-57393PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for JAMP Recombinant Protein Antigen (NBP2-57393PEP)

Find related products by research area.

Blogs on JAMP.

JAMP (JNK1/MAPK8 associated membrane protein)
JAMP is a seven-transmembrane protein that is a regulator of JNK/MAPK8 activity in response to various stress stimuli. This regulation is part of a broader collective and coordinated response to clearing misfolded proteins from the ER. JAMP facilit...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our JAMP Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol JKAMP