Jak3 Recombinant Protein Antigen

Images

 
There are currently no images for Jak3 Recombinant Protein Antigen (NBP2-49629PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Jak3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Jak3.

Source: E. coli

Amino Acid Sequence: ETFHVGLPGALGGHDGLGLLRVAGDGGIAWTQGEQEVLQPFCDFPEIVDISIKQAPRVGPAGEHRLVTVTRTDNQILEAEFPGL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
JAK3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49629.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Jak3 Recombinant Protein Antigen

  • EC 2.7.10
  • Jak3
  • JAK3_HUMAN
  • JAK-3EC 2.7.10.2
  • JAKL
  • JAKLtyrosine-protein kinase JAK3
  • Janus kinase 3Leukocyte janus kinase
  • LJAK
  • L-JAKJanus kinase 3 (a protein tyrosine kinase, leukocyte)

Background

Jak3 (Janus Kinase 3) belongs to the family of non-receptor Janus tyrosine kinases, which regulate a spectrum of cellular functions downstream of activated cytokine receptors in the lympho-hematopoietic system. Immunological stimuli, such as interferons and cytokines, induce recruitment of Stat transcription factors to cytokine receptor-associated JAK3. JAK3 then phosphorylates proximal Stat factors, which subsequently dimerize, translocate to the nucleus and bind to cis elements upstream of target gene promoters to regulate transcription. The canonical JAK/Stat pathway is integral to maintaining a normal immune system, stimulating proliferation, differentiation, survival and host resistance to pathogens. Altering JAK/Stat signaling to reduce cytokine induced pro-inflammatory responses represents an attractive target for anti-inflammatory therapies.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4260
Species: Hu, Mu, Rt
Applications: Simple Western, WB
202-IL
Species: Hu
Applications: BA
NBP2-59451
Species: Hu
Applications: ELISA, Flow, ICC/IF, MiAr, Simple Western, WB
6507-IL/CF
Species: Hu
Applications: BA
AF2168
Species: Hu, Mu
Applications: ChIP, Simple Western, WB
AF1584
Species: Hu, Mu
Applications: CyTOF-ready, ICC, IP, ICFlow, KO, Simple Western, WB
MAB1799
Species: Hu, Mu, Rt
Applications: ICC, IP, ICFlow, KO, WB
207-IL
Species: Hu
Applications: BA
NB400-141
Species: Ha, Hu, Mu
Applications: ICC/IF, IP, WB
247-ILB
Species: Hu
Applications: BA
AF2894
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
MAB3427
Species: Hu
Applications: WB
AF284
Species: Hu
Applications: CyTOF-ready, Flow, Neut, WB
NBP2-25241
Species: Hu, Mu
Applications: ICC/IF, IP, WB
M6000B
Species: Mu
Applications: ELISA
409-ML
Species: Mu
Applications: BA
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
DY413
Species: Mu
Applications: ELISA
NBP2-49629PEP
Species: Hu
Applications: AC

Publications for Jak3 Recombinant Protein Antigen (NBP2-49629PEP) (0)

There are no publications for Jak3 Recombinant Protein Antigen (NBP2-49629PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Jak3 Recombinant Protein Antigen (NBP2-49629PEP) (0)

There are no reviews for Jak3 Recombinant Protein Antigen (NBP2-49629PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Jak3 Recombinant Protein Antigen (NBP2-49629PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Jak3 Products

Research Areas for Jak3 Recombinant Protein Antigen (NBP2-49629PEP)

Find related products by research area.

Blogs on Jak3.

Signal Transducer and Activator of Transcription STAT6: More than a Player in Allergic Inflammation
By Jamshed Arslan, Pharm. D., PhD. What is STAT6?The cellular pathway comprising tyrosine kinase Janus Kinase (JAK) and the transcription factor STAT connect extracellular signals from various cytokines, hormones an...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Jak3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol JAK3